KEGG   Nectria haematococca: NECHADRAFT_99132Help
Entry
NECHADRAFT_99132  CDS       T01612                                 

Definition
(RefSeq) hypothetical protein
  KO
K10967  alpha 1,2-mannosyltransferase [EC:2.4.1.-]
Organism
nhe  Nectria haematococca
Pathway
nhe00514  Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:nhe00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    NECHADRAFT_99132
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:nhe01003]
    NECHADRAFT_99132
Enzymes [BR:nhe01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     NECHADRAFT_99132
Glycosyltransferases [BR:nhe01003]
 Glycan extension
  Yeast mannan chain
   NECHADRAFT_99132
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_15
Motif
Other DBs
NCBI-GeneID: 9668079
NCBI-ProteinID: XP_003045884
JGI: 99132
UniProt: C7Z6Q0
LinkDB All DBs
Position
2
AA seq 466 aa AA seqDB search
MAAGHTRYVRYIALALFTLTMFYFFSNSRYETIPVTGNVGNFPGGPGSPATGSNQQAPGT
VPNAPNSGNSVNFPQGETAPVPGDDDTSLTKDEIPAQKPAAEGAAPVEPEGAAKPADELA
NAPMAMNPGEPGWDNLLGTAPGPRMNATFVTLARNSDVWEIAESIRQVEDRFNRRYNYDW
VFLNDKPFDDQFKKVTSSLCSGKTHYGLIPEEHWSFPEWIDQEKAKKVREDMAARKIIYG
DSVSYRHMCRFESGFFFRQEIMMNYEYYWRVEPSVKLFCDIHYDPFRVMHENNKKYSFVL
SLYEYIDTIPTLWDSTKKFMANHPEHISEDNSMRFLSDDGGNTYNKCHFWSNFEVGSLSW
LRSKPYLDFFESLDKDGGFFYERWGDAPVHSIAAGLLLKKEQIHFFNDIAYYHVPFTHCP
TGEQKRLDLRCHCNPKENFDWKGYSCTSRYYELNGIEKPQGYEEQQ
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atggctgctggtcatacgcgctacgtgcgctacattgcgctcgcgctctttacgctcact
atgttctacttcttctccaactcgagatacgagaccatccccgtcaccggcaacgttgga
aacttccctggtggccccggaagccctgcaactggtagcaaccagcaggctcctggcact
gttcccaatgcccccaactctggcaactctgtcaacttcccccaaggagagaccgccccc
gttcccggcgatgatgatacctccctcaccaaggacgagattcccgcccagaagcctgct
gctgagggcgctgctcccgttgagcccgagggcgccgctaagcctgccgatgagctcgcc
aacgctcccatggccatgaaccccggcgagcctggttgggacaacctcctgggcactgct
cctggtccccgcatgaacgccacctttgtcactcttgctcgaaacagcgacgtttgggag
attgccgagtctatccgtcaggtcgaggatcgattcaaccgacgatacaactacgactgg
gtcttcctcaacgacaagcccttcgatgatcagttcaagaaggtcaccagctctctctgc
tctggtaagactcactacggtctgattcctgaggagcactggtccttccccgagtggatt
gaccaggagaaggccaagaaggttcgtgaggatatggccgcccgcaagatcatctacggt
gattccgtcagctaccgccacatgtgccgattcgagtctggtttcttcttccgacaggag
atcatgatgaactacgagtactactggcgcgttgagccctctgtcaagctcttctgcgat
atccactacgaccccttccgtgtcatgcacgagaacaacaagaagtacagcttcgttctc
tctctctacgagtacattgacaccattcctactctctgggacagcaccaagaagttcatg
gccaaccaccccgagcacatttccgaggacaactcgatgcgattccttagtgacgatggc
ggcaacacctacaacaagtgccacttttggtccaactttgaggttggtagcctgtcttgg
ctccgaagcaagccttacctcgacttctttgagtctctcgacaaggacggtggtttcttc
tacgagcgatggggtgatgctcccgttcactctatcgctgctggtcttctcctcaagaag
gagcagattcacttcttcaacgacattgcctactaccacgttcccttcactcactgcccc
actggtgagcagaagcgtcttgatctccgttgccactgcaaccccaaggagaactttgac
tggaagggctactcttgcacctcccgatattacgagctcaacggtattgagaagcctcag
ggttacgaggagcagcagtaa

DBGET integrated database retrieval system