KEGG   Candidatus Nanopelagicus hibericus: B1s21160_05080Help
Entry
B1s21160_05080    CDS       T05090                                 

Definition
(GenBank) nickel superoxide dismutase
  KO
K00518  nickel superoxide dismutase [EC:1.15.1.1]
Organism
nhi  Candidatus Nanopelagicus hibericus
Brite
KEGG Orthology (KO) [BR:nhi00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    B1s21160_05080
Enzymes [BR:nhi01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     B1s21160_05080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Ni DUF2937
Motif
Other DBs
NCBI-ProteinID: ASY13682
UniProt: A0A249KA88
LinkDB All DBs
Position
987200..987607
Genome map
AA seq 135 aa AA seqDB search
MFNSLIKAIAPKETVFAHCDLPCGVYDPAQAKIEAQSVKACMEKYAASSDPDFKARAVAI
KEERSELVKHHLWVLWTDYFKANHFETYPQLHSLFNEATKLAGAGGSKGTNDVAVASKLI
GKIDEIAEIFWATKK
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atgtttaattctttaatcaaagcaattgcaccaaaagaaacagtttttgcacattgcgat
ctaccatgtggtgtttatgatcctgcacaagcaaaaattgaggctcaatcagtaaaagct
tgtatggaaaaatatgccgcaagcagtgaccctgatttcaaagcacgcgctgttgcaatc
aaggaagaacgttcagagttggtcaagcatcacttatgggtattgtggactgactacttc
aaagcaaatcactttgaaacctatcctcaactccactcactatttaacgaggcaacaaaa
cttgctggtgcaggtggaagtaaaggcacaaatgatgtggcagtggccagcaaattaatc
ggtaaaatcgatgaaatagcagaaattttctgggcaactaaaaaataa

DBGET integrated database retrieval system