KEGG   Nitrosococcus halophilus: Nhal_0828Help
Entry
Nhal_0828         CDS       T01198                                 

Definition
(GenBank) Serine/threonine protein kinase-related protein
  KO
K11912  serine/threonine-protein kinase PpkA [EC:2.7.11.1]
Organism
nhl  Nitrosococcus halophilus
Pathway
nhl03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:nhl00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Nhal_0828
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nhl01001]
    Nhal_0828
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:nhl02044]
    Nhal_0828
Enzymes [BR:nhl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Nhal_0828
Protein kinases [BR:nhl01001]
 Serine/threonine kinases: Other
  Bacterial family
   Nhal_0828
Secretion system [BR:nhl02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   Nhal_0828
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Pkinase_fungal Kinase-like Kdo Fis1_TPR_C TPR_1 DUF1679
Motif
Other DBs
NCBI-ProteinID: ADE14004
UniProt: D5BXP6
LinkDB All DBs
Position
836782..838056
Genome map
AA seq 424 aa AA seqDB search
MSISEEQAKEVSSLKIPGYRIQRMIGQGGMAKVYLAIQESLERKIALKIMTPPLDIDHSL
CERFLKEGKIVAQLSHPSIITVYDVGCFGNHYYMAMEYLGGANLKQRIQQQAPVVCPLKI
IRQVASALGYAHAHGFVHRDVKPANILFKEDGTAVLTDFGIAKPLTAHTQLTAVGFCVGT
PEYMSPEQATGKKLDGRSDLYSLGVVFYEMLTGQKPFIGDDAIATILMHAQSPIPSLPSQ
FAIYQPLVEHLLAKDPHDRFEDAEALIAFIDHLSGPSEKELPQKTGTSRWSPTQVMPGGT
RVLVEPSSEKKSSTYRARRWAMGIGLLALVFLGIYLFLSPSLIGPQSNEPLKQVEVFPKK
SQDQERVEHLLNVAEVHAAVGRLTEPPGSNAYEAYKMVLEIDPDNEQAQKGLRKIENLKS
QKHE
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgagcatctccgaggagcaagcgaaagaagtctcttccctgaaaattcctggttatagg
atccagaggatgattggtcagggggggatggcgaaggtttatcttgctatccaggagtcc
ctggagcgaaagattgcccttaagatcatgacgcctccccttgatatcgaccattcattg
tgtgagcggttcttaaaggaggggaagattgtcgcccaattaagccatccgagtatcatc
accgtgtatgacgtcggttgttttggtaaccattactatatggctatggagtatcttggc
ggagccaatcttaagcaacgtatccagcagcaagcccctgtggtctgccctttgaagatt
atccgccaagttgccagtgccttgggttatgcccatgctcatggatttgttcaccgggat
gtcaagccggccaatatcctctttaaggaagatggcactgcagttctgactgatttcggt
atcgctaaaccactgaccgcccacactcagctgactgcggtgggtttctgtgttggaaca
cccgaatacatgagcccggagcaagcgacgggcaaaaagctggatggacgttccgatctt
tacagcctaggagtggtgttctacgagatgctgacgggccagaaaccttttataggagat
gatgcgattgctacgattttgatgcatgcgcaaagccctatccccagtttaccttcccag
tttgccatctatcagccccttgtagagcatttgttggctaaagatccccatgaccgattt
gaggatgcggaggcattaatcgccttcattgatcatttgtctggcccttccgagaaggaa
ctacctcaaaaaaccgggacttcacgctggtcccccacccaagtaatgccgggagggact
cgggtattggttgagcctagttcggagaagaaatcgtcaacttacagggctaggcgctgg
gcgatggggatcgggttgttggctttagtctttttggggatttacctttttctttctccc
tccctgatagggcctcaatccaacgaacctctaaagcaggtggaagtatttcctaaaaaa
tctcaagatcaggaaagagtcgagcacctgcttaatgttgctgaagtccacgcggcagtg
gggcgattaacggaacctccgggcagcaatgcctacgaagcttacaaaatggtgctagaa
attgatccagataatgaacaggcccaaaaggggctccggaaaattgaaaatctgaagtca
caaaaacatgaatag

DBGET integrated database retrieval system