KEGG   Nitrosococcus halophilus: Nhal_1306Help
Entry
Nhal_1306         CDS       T01198                                 

Definition
(GenBank) phosphoenolpyruvate phosphomutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
nhl  Nitrosococcus halophilus
Pathway
nhl00440  Phosphonate and phosphinate metabolism
nhl01100  Metabolic pathways
nhl01120  Microbial metabolism in diverse environments
nhl01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:nhl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    Nhal_1306
Enzymes [BR:nhl01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     Nhal_1306
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase NTP_transf_3 NTP_transferase ICL
Motif
Other DBs
NCBI-ProteinID: ADE14458
UniProt: D5C0D2
LinkDB All DBs
Position
complement(1299575..1301248)
Genome map
AA seq 557 aa AA seqDB search
MSTVPLPTTTDLKRQPSKFAQLRDLLESKQTEFLMEAHNGLSARIVEEAGFKGIWASGLA
ISSQFGVRDNNEASWTQIVDMLEFMSDATRIPILLDGDTGYGNFNNLRRLVRKLEQREIA
GVCIEDKVFPKTNSFISGERQPLADVDEFCGKIKAGKDSQNDPDFSIVARVEALIAGWGL
DEALRRAEAYHGAGADAILIHSKLSQADEILAFAREWAGRAPLIIVPTKYYSTPTEVFRK
ADISVVIWANHLIRAAAAAMAEVAREIYGTETLVNIEDQVAPVSEIFRLQGAEELLAAER
RYTASPDAETGAIVLAATRGEGLESMTQERPKVMLPVAGVPLLRRLVDKFKRQNINHITT
VTGYKPEAIDVKGISLVHNPDYALSGELSSLTCALEALSEDTIITYGDLLFRSYILRDLR
HMPGNIVVVVDSAMPPGKRENIRDAAFCSQPDDRSLFRQDVELLRVETQREKIHGRPSGR
WIGMVRVAGEGHQWLLKGLQALRQQENFPQLGMPDLLNHLVASGHPIKVLYINGHWLDVN
NMEDLTRAGDFAHGHQQ
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgagtactgtacccctacccaccactaccgatctgaaacgccagccgtcaaagtttgcc
caattacgcgacttactggaatccaagcaaacggaatttctaatggaagcccacaatggc
ctgagtgctcgcattgttgaagaagctggatttaagggaatttgggccagtggtcttgct
atttcttcccagtttggggtgagggacaataatgaagccagttggacccagatagtggat
atgctggaatttatgtccgatgccacccgcattcccattctcctagacggcgatacggga
tacggaaattttaataatttgcgccgactagtgaggaaactagaacaaagggagattgca
ggggtttgtattgaagataaagtcttccctaaaaccaacagctttatctccggtgagcgc
cagcccttggctgatgtggatgaattttgcggtaagatcaaggcgggcaaggattcccaa
aatgatccggatttctccattgtggctcgagtcgaagccttaattgcgggttggggccta
gatgaagctttgcgccgtgccgaagcctaccatggggcgggcgccgacgccattttgatc
catagtaaactgtcccaagccgatgagatcctggcctttgcccgggaatgggcggggcgg
gcgccactgattattgtccccaccaaatactacagtacccccaccgaggtattccgcaag
gcggatatcagtgtcgtgatctgggccaatcatttaatccgagccgctgcggcggcgatg
gctgaggtagcgcgggaaatttatggcactgagaccctggttaacattgaggatcaagtg
gctccagtcagtgaaatcttccgcctccagggggccgaagagttactcgctgctgaacgc
cgctacaccgcgtcaccagatgccgagaccggggctattgtcctggcggcaacccgaggg
gaaggactggaaagtatgacccaggaacgccccaaggtcatgttaccggtcgctggggtc
cccttgttacgccgcctggtagataagtttaagcgtcaaaacatcaatcacatcaccacg
gtcacgggctataaaccagaagccattgatgtgaagggcatatccctggtccataatcca
gactacgccctgagcggcgagctctcctccctcacctgcgcccttgaagccttgtccgag
gataccatcatcacctatggcgatctcttgttccgcagctatatcttaagagatctgcgt
cacatgcctggaaacattgtagtggtagtagactccgccatgccccctgggaaaagggag
aatatccgcgacgcagccttttgttcccaaccggatgaccgctccttgttccgccaggat
gtggagctgcttcgggttgaaacccaaagagagaaaatccacgggcggcccagcggccgc
tggatcggaatggtacgcgtggcgggtgagggccaccaatggctgctcaagggcctccaa
gcattgcggcaacaagagaattttccccaactggggatgccggatctgctgaatcatctg
gtggccagcggccatcccatcaaggttctctacattaacggccactggctggacgtaaat
aatatggaggatctgacccgcgccggcgattttgcccacggtcaccaacaatga

DBGET integrated database retrieval system