KEGG   Nitrosococcus halophilus: Nhal_1877Help
Entry
Nhal_1877         CDS       T01198                                 

Definition
(GenBank) Hsp33 protein
  KO
K04083  molecular chaperone Hsp33
Organism
nhl  Nitrosococcus halophilus
Brite
KEGG Orthology (KO) [BR:nhl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:nhl03110]
    Nhal_1877
Chaperones and folding catalysts [BR:nhl03110]
 Heat shock proteins
  HSP33
   Nhal_1877
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP33
Motif
Other DBs
NCBI-ProteinID: ADE14992
UniProt: D5C3M0
LinkDB All DBs
Position
complement(1930828..1931697)
Genome map
AA seq 289 aa AA seqDB search
MIDRDNLHRFLFEELGIRGELVQLDASWQAVLTCHDYPSAVQSQLGQALVATVLLSATIK
FKGSLILQAQSEGPLKTLVAQATHHRTVRGLARWNGEVPRGSLPEIYGSGRLVLTIQTEG
KDPYQGIVSLEGTNLAEALQTYFSRSEQLQTRLWLFADEHRAVGLFLQELPSQPGDETDW
ERITLLANTVTAREMLSLPSTELLYRLFNGEQLRLFEPEPISFRCGCSRERIENTLVALG
REEMEAILEEEGTVEVDCEFCNRHYSFDRVDVEQLFAEQVKTPVPSTRH
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgattgatcgggataatttacaccgcttcttgttcgaagagctcgggatccgaggtgag
ctggtccaacttgatgctagctggcaggccgtgcttacctgccatgactacccttctgcg
gtacagtcccagcttggtcaggcgttagtggctacggttttgctctcggccaccattaaa
tttaagggttcccttattctccaagcccagagcgaaggccccctgaaaaccctggtggca
caagccactcaccatagaaccgtacgtggattagcccgctggaatggcgaggtcccccgg
ggatcgcttccagaaatatacggttccggacgcctggtgctcaccatccaaacagaaggc
aaagatccttaccagggaattgtttccctggaaggcaccaacctagccgaagccctgcaa
acctatttttcccgttcagaacagcttcaaacccgcctttggttgtttgccgatgagcac
cgggcggtaggactgtttctccaggagttaccctcccagccaggagacgagacggattgg
gagcgcatcacattgctggcgaacaccgtcaccgcacgagaaatgttatcgttacccagt
acagaattgctctaccggttattcaatggagagcagcttcgtctatttgagccggaaccg
atctccttccgctgtggttgctcccgggagcggatcgagaataccctagtcgctttggga
cgagaggaaatggaagctattctggaagaggaaggcacagttgaagtagactgcgagttt
tgcaatcgccactacagttttgaccgagtggacgtggagcaactatttgctgagcaggtg
aaaactcccgtaccctctacgcggcattga

DBGET integrated database retrieval system