KEGG   Nitrosococcus halophilus: Nhal_2491Help
Entry
Nhal_2491         CDS       T01198                                 

Definition
(GenBank) trehalose synthase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
nhl  Nitrosococcus halophilus
Pathway
nhl00500  Starch and sucrose metabolism
nhl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nhl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Nhal_2491
Enzymes [BR:nhl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Nhal_2491
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     Nhal_2491
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C Mak_N_cap APH DUF3459 hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: ADE15576
UniProt: D5BVZ7
LinkDB All DBs
Position
2564642..2567974
Genome map
AA seq 1110 aa AA seqDB search
MNQQGEEFSWQDDPLWYKEAIIYQLHVRAFLDSNNDGTGDFQGLTQKLDYIQDLGVNTIW
LLPFYPSPLRDDGYDIADYRNIYPDYGTRRDFRNFVRAAHRRGLRVITELVINHTSDQHQ
WFQAARKAPPGSAKRNFYVWSNSDQKFPETRIIFTDTETSNWAWDPVAKAYYWHRFFSHQ
PDLNHNNPQVVKAVIRVMRFWLDMGVDGLRLDAIPYLCVREGTHNENLPETHEVLKQMRA
VVDDHYRHRMFLAEANQWPEDVREYFGDGDECHMAYHFPLMPRMYMAIAQEDRHPITEIM
NQTPDIPESCQWAIFLRNHDELTLEMVTDKERDYMYQTYATNPRMRVNVGIRRRLAPLMD
NDLDKIQLMNSLLLSMPGSPIIYYGDEIGMGENIYLGDRNGVRTPMQWSPDRNAGFSKAD
PQRLYLPPIMDPIYGYEAVNVEAQSRDPSSLLNWMKRLLAVRKNTQAFGRGTLKFLRPGN
RKILAYVREYGGEAILCVANLSRYAQPVELDLSRFKGRVPLEMMGHTPFPPIGELPYLLT
LPSHGFYWFRLATDVEEPSWHEERLPPLELPVLVLFAGWDSLFPSRVDPPRKRMSEKLCG
QLEQLLRDFLITQRWFAAKGEEVERVRLEQMEEWTEEAGSWLLARVRVEFADIEVQSYFI
PLALAWGEGDEEPIRRLLPSTIAKIRRQARIGILYDALADVSFSRALVTAMGQHREIPFG
AGKLKFSPTAAFEKLVNGVSLQQLWRPAMEGTNSTLILDNRLFLKIYRHLQEGINPEQEM
GHFLTEASPFPNIVPLAGTLESLGPEGTPMTLALLQGFVPNQGDAWAYTVDYLERFLENS
LAKPLEEAAIEFGETHNNYLRMIRILGQRTGELHQALAKETGNPAFDPEPINSADLDSWR
KHIEKDIEQTLKMLEQRRSEFSEPLRTEVDCLLALKETLRQRLALIPPELRAVKTRYHGD
YHLGQVLVAEDDFVIIDFEGEPARPLAERRIKHSPLRDVAGMLRSFNYATAVALRHCTVE
RPEDRGLLLPLAHTWERQVGESFLAGYGEAAAGCPSYPADPEHAHYLIELFILEKALYEL
RYELDNRPEWVDVPLNGLLEFLEEEENPGE
NT seq 3333 nt NT seq  +upstreamnt  +downstreamnt
atgaaccagcaaggagaagaatttagctggcaggatgatccgctttggtataaggaggcg
attatctatcagctccatgtaagggcctttttggatagcaataatgatggtacgggagat
ttccagggccttacccagaagttggattacattcaggatctaggggtgaatacgatctgg
ttattgcccttttatccttccccgttgcgggatgatggttatgatattgctgattaccgt
aacatctatccagattacggaacccggagagactttaggaactttgtgcgggcggcccac
cgccgcggcttaagagtcatcactgaactggtgatcaaccatacttcggatcagcaccag
tggtttcaagccgcccgcaaggcgccccccggttcggccaaacggaatttttacgtctgg
agcaatagcgatcaaaaatttcccgagacccggattattttcaccgacacggaaacctct
aactgggcctgggatccagtcgccaaggcctattactggcatcggtttttttctcaccag
ccggatctcaaccataacaacccccaggtggtgaaggcggtgatccgggtcatgcgtttt
tggctggatatgggggtcgatggcttgcgcttggatgccattccctacctttgtgtgcgg
gagggcacccacaacgagaatcttcctgaaacccatgaggtgcttaaacagatgcgggcg
gtggtggatgatcactatcggcaccgaatgtttttggcggaggctaatcaatggccggag
gacgtgagggaatatttcggtgacggcgatgaatgccatatggcctaccatttccccctc
atgccgcggatgtatatggccatcgcccaagaagatcgccaccccatcaccgaaatcatg
aatcaaactccggatattccggagagttgccagtgggcgatttttctgcgtaatcatgat
gaactcaccctggagatggtcaccgacaaggaacgggactacatgtatcagacctatgcc
accaaccctcgcatgcgggtcaatgtgggtatccggcggcgtctggcaccgttaatggac
aacgatctggacaagatccagttgatgaatagtttgctcctctccatgcccggctcgccc
attatctactatggagatgagattgggatgggggaaaacatttatttgggtgatcgcaat
ggcgtgcgcacgcccatgcagtggagtccggaccgtaatgccggtttttcgaaagccgat
ccccaacgcttgtatctaccgcctatcatggaccccatttatggctacgaggccgtcaat
gtggaagcccagagccgggatccgtcctcccttctcaattggatgaagcgcctgctggcg
gtgcgcaagaatacccaggcctttgggcgcgggaccctaaaatttcttcggcctgggaat
cgcaagatcctggcgtatgtgcgggagtatgggggtgaagctatcttatgtgtcgccaat
ttgtcccgttatgctcagccggtggaattggacctctcccgttttaaggggcgcgtgccc
ctagagatgatgggacacaccccttttcctcccattggcgaattgccctatttgttgacc
ttaccaagccatggattttattggtttcggttggccacggatgtggaggagccctcttgg
cacgaggagcgtttgcccccgctggaattgcccgtattagtattatttgcaggctgggac
agtttatttcctagccgcgtcgatcccccccgtaagcggatgtccgaaaaattgtgtggg
caattagaacaactattacgggattttttgataacccaacgctggtttgcggctaaagga
gaggaagtcgagcgtgtccggctggagcagatggaggaatggacggaagaagcgggaagt
tggttacttgctcgggtaagggtcgagtttgccgatattgaagtccagtcttattttatc
cctttagcccttgcctggggggagggtgatgaggagcccatacgccgcttgttgccatcc
actatcgccaagattcggcggcaagcccgcattggtattttgtatgatgctttagcggat
gtgagttttagccgggcattagtcacggcaatgggacagcatcgggagatcccttttggg
gccgggaaactaaaattttctccgaccgctgcttttgaaaaattggtcaacggtgtttcc
ctgcagcagctgtggcgtccggccatggagggcactaatagcaccttgatcctagataat
cgattgtttctgaaaatttaccgtcatttgcaggaaggcatcaatccagaacaggagatg
gggcattttctcacggaagcatcgccctttcccaatattgtcccccttgcaggcactttg
gagtctctgggtcctgagggaacgccaatgaccttagccctattacaaggttttgttccc
aaccagggggatgcctgggcttataccgtggattatttggaacgctttttggaaaacagt
ctggcaaaaccccttgaggaagcggccatcgagtttggcgaaacccataacaattacctc
agaatgatacgaatcctggggcagcgcacgggagagttgcatcaggcattggctaaggag
acagggaatccggcttttgatccagaacccatcaattccgctgatttggactcctggcga
aagcatattgaaaaggacattgagcagactttaaagatgctagaacagcgtaggagtgag
ttttctgaaccgctgcgcaccgaggtggattgcctcttagccctcaaggagaccttacgg
caacgtcttgctttaattcctcccgaattacgtgccgtcaagacccgctatcatggtgac
taccacttggggcaggttttggtggcggaggatgactttgtcattattgattttgaaggg
gagccggcccgtcccttagccgagcgccggattaagcattcaccgctgcgggatgtggcc
ggcatgttgcgctctttcaattatgccaccgccgtggccctgcgccattgtaccgtggag
cgccccgaggatcgggggttactcctccccttggcccacacctgggagcggcaggtgggg
gaaagttttctggccggctatggtgaagcggctgcgggttgtccctcttatcccgcagac
ccggaacacgctcactatttgattgagttgtttatcttggaaaaggcgctctacgaactc
cgctacgagctagacaatcgaccggaatgggtggatgtgcccctcaatggattgctggaa
ttcttggaggaggaggaaaacccgggggaataa

DBGET integrated database retrieval system