KEGG   Nitrosococcus halophilus: Nhal_3587Help
Entry
Nhal_3587         CDS       T01198                                 

Definition
(GenBank) D-alanine--D-alanine ligase domain protein
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
nhl  Nitrosococcus halophilus
Pathway
nhl00473  D-Alanine metabolism
nhl00550  Peptidoglycan biosynthesis
nhl01100  Metabolic pathways
nhl01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:nhl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Nhal_3587
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Nhal_3587
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Nhal_3587
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:nhl01011]
    Nhal_3587
Enzymes [BR:nhl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Nhal_3587
Peptidoglycan biosynthesis and degradation proteins [BR:nhl01011]
 Precursor biosynthesis
  Amino acid ligase
   Nhal_3587
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C ATPgrasp_Ter ATP-grasp_3 ATP-grasp_4 GSP_synth
Motif
Other DBs
NCBI-ProteinID: ADE16610
UniProt: D5C222
LinkDB All DBs
Position
complement(3687834..3688886)
Genome map
AA seq 350 aa AA seqDB search
MPAVRDDFCPPRELIFPHITVILGDPRLPDESKIGGRFSAEDIEAVDRVKEALGELQDYR
FTYLDNHSTLIANLTADPPDFVLNFCDTGYKNQARQELHIPALLEMLGIPYSGAGPTCLG
MCYDKSLVRSVARTHGIPVPAETFVRGNDRHGAVSQNFPVLIKPNRADGSLGITKDSLVH
DEQQARAYLNKLAMEFPNWDLLIQEFLPGEEYSVGVLGNPASGFMILPILAVDYSKLVAS
RLPPILAYASKIDPQSPYWTDIKYCEASLKEDLRQRLVDYCLFLFERLGCRDYARFDFRT
DAQGEIKLLEVNPNPAWCWDGKLNLMAGFAGYHYAELLERILHAAQVRYR
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgcctgcagttagggatgatttttgcccccctagggagctgattttcccccatatcaca
gtcattttaggtgatccgcgcttgccggatgaatccaaaatcggcggccgctttagtgcc
gaggatatagaagcggttgacagagttaaagaggccttgggagagttgcaggattaccgc
tttacttatttggataaccattcgacgctgatcgccaatctcaccgccgatcctccggac
tttgtcctcaatttttgtgatacgggctataaaaaccaagctcgtcaggaactccatatc
ccggcactgctggaaatgcttggaatcccctatagcggtgcagggcccacttgtctgggg
atgtgctatgacaagtccttagtgcggtcggtggcgaggacccatggcattcctgtgcct
gccgaaacctttgttcgcggcaatgaccgccatggggcagtatcccaaaattttcctgtt
ttaatcaaacctaaccgggcagatggcagtttggggatcaccaaagactccctggtccac
gacgaacagcaagcccgcgcctatctcaataagctcgctatggaattcccgaactgggat
ttgctgatccaagaatttttacccggcgaggaatatagcgttggcgtactgggtaatcca
gcctctggttttatgatattgcctatcctagcggtggactatagtaagctggtggccagt
cgtttaccccccatcctggcctatgcttctaaaatcgatcctcaatcaccttactggacc
gatattaaatattgtgaggcctccctgaaggaggatctgcgccagcgtttggtggattat
tgcctgttcttattcgaacggttgggttgccgggattatgcccggttcgacttccgcacc
gatgcccagggtgaaattaaattgttagaggtcaatcctaatcctgcttggtgttgggat
ggcaagttgaatttgatggcgggatttgccggataccattatgccgagctattggaaaga
atcctccatgctgcccaagttcgatatagataa

DBGET integrated database retrieval system