KEGG   Nitrosococcus halophilus: Nhal_3886Help
Entry
Nhal_3886         CDS       T01198                                 

Definition
(GenBank) Shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
nhl  Nitrosococcus halophilus
Pathway
nhl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
nhl01100  Metabolic pathways
nhl01110  Biosynthesis of secondary metabolites
nhl01130  Biosynthesis of antibiotics
nhl01230  Biosynthesis of amino acids
Module
nhl_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:nhl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Nhal_3886
Enzymes [BR:nhl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     Nhal_3886
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 AAA_22 Cytidylate_kin TsaE AAA_5 AAA_33 AAA dNK AAA_16 AAA_24 Cytidylate_kin2 ABC_tran Mg_chelatase RNA_helicase RuvB_N SRP54 AAA_28 PduV-EutP Ploopntkinase3 AAA_23 APS_kinase cobW Rad17
Motif
Other DBs
NCBI-ProteinID: ADE16898
UniProt: D5C3J1
LinkDB All DBs
Position
complement(4005569..4006117)
Genome map
AA seq 182 aa AA seqDB search
MARNIFLVGPMGAGKTTLGRYLAKMLGRKFHDSDREIECRTGVSIPVIFEIEGEAGFRQR
ECKMIAELTQLSNIILATGGGAVLAIENRQRLAQGGTVVYLYASPEQLYRRTVHDSNRPL
LQTENPLERLKRLLKERDPLYREVADITIKTGERPIKAVANEVLRQLKRYGNVHGQKFSA
IR
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atggctagaaatattttcctcgtgggtccaatgggggccggtaaaacgacccttggtcgg
tacttggcaaagatgctgggtagaaaattccatgatagcgatcgtgaaatcgaatgccgc
accggggtcagtattcccgtaatctttgaaatcgagggggaggccggttttcggcagcgt
gagtgtaagatgattgctgagcttacccagctaagcaatattatattggcaactggcggg
ggagcggtgcttgccattgagaatcgacagaggttggcgcagggaggaaccgtcgtctat
ttgtatgcatcaccagaacaactctatcgccgtactgtccatgatagcaaccgcccttta
ttgcagacggaaaatccgttagagcgcctgaaacgcttactcaaggagcgcgatcccctg
tatcgagaagtggcggatatcaccatcaaaacaggtgaacgacccatcaaggccgttgcc
aatgaggtgctccggcagcttaaacggtatggaaatgttcacgggcagaagttttccgcc
atacgctaa

DBGET integrated database retrieval system