KEGG   Nitrosococcus halophilus: Nhal_3892Help
Entry
Nhal_3892         CDS       T01198                                 

Definition
(GenBank) penicillin-binding protein, 1A family
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
nhl  Nitrosococcus halophilus
Pathway
nhl00550  Peptidoglycan biosynthesis
nhl01100  Metabolic pathways
nhl01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:nhl00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Nhal_3892
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    Nhal_3892
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:nhl01003]
    Nhal_3892
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:nhl01011]
    Nhal_3892
Enzymes [BR:nhl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     Nhal_3892
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Nhal_3892
Glycosyltransferases [BR:nhl01003]
 Polysaccharide
  Bacterial polysaccharide
   Nhal_3892
Peptidoglycan biosynthesis and degradation proteins [BR:nhl01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   Nhal_3892
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase PCB_OB 3-alpha
Motif
Other DBs
NCBI-ProteinID: ADE16904
UniProt: D5C3J7
LinkDB All DBs
Position
4011511..4013949
Genome map
AA seq 812 aa AA seqDB search
MTYFPRLLRWMVALLLTATTIGILIALGIYFYLVPQLPSTEALKDVQLQVPLRVYSQERK
LIAEYGEKRRTPLTFEQFPDLLVKAVLAAEDDRFYEHPGVDYQGILRAALYLIKTGKKGQ
GGSTITMQVARNFFLSREKTYLRKLNEILLALQIERELSKQDIIELYLNKIYLGNRAYGV
AAAAQVYYGTTLDKLELSQLAMVAGLPKAPSRYNPLANPERALLRRNYVLRRMHEVGYID
DKTYQNAVAQPITAKFHGLPVELEAPFVAEMARSQLFEEYGPDIYTAGYNVYTTIKAEHQ
EAATNALRSALLAYDQRHGFRGTKQQVELPEGADEAFYRQVLSQYRIANGLVPALVLATE
EQTSQVYTKTDGEVLLSWEGLSWARPYLGVNALGKKPKQAADILQAGDLIRLEALPEGGW
RLAQTPQVEGAIVSLSPDNGGITALSGGFDFYRSKFNRAIQSQRQPGSSFKPFLYSSALN
KGYTAASVINDAPIVLDEPGLENVWRPENYSGRFYGPTRLRVALIHSRNLVSVRLLRAIG
IDYAIEYIQRFGFEPEQLPQSLSLALGSGSASPLEMARGFAVFANGGHLIKPHLIERIEN
ANGQIIFQARSPQVCQHCEELEAEQAPIPNLTSLPLQDAKLISQPLPAPQVITPQNAYLI
YSMLQDVIRHGTGRRAKQLGRNDLAGKTGTTNDQHDAWFSGFNSELVAVCWVGFDQPKSL
GSFETGARAALPMWINYMDAVLDGEPEKPLIPPKGIVTVRIDPETGLLARPNTPNAIFET
FLAEHAPVKYATSSRQSDSSAKTDTPITEQLF
NT seq 2439 nt NT seq  +upstreamnt  +downstreamnt
atgacatatttccctcgcctgctccgctggatggtggctttgttgcttactgccacaaca
attggtatccttattgccctagggatatacttctatctggtaccccaactaccctctact
gaagcgctcaaggatgttcagcttcaggttcctctacgcgtttattcccaggaaagaaag
cttattgccgaatatggagaaaaacgccgcactcctttaacttttgaacaatttccagac
ttgctggttaaagccgtactagccgcagaagatgatcgcttctatgagcatcctggtgtc
gactatcaaggtatcctccgcgctgccttatatttgataaagaccggtaaaaagggccag
ggcggcagcactattactatgcaagttgcccgcaatttctttttaagtagggaaaaaacc
tacttacgtaagctcaatgaaattctgctagctctacagatcgaacgagagcttagtaaa
caggacatcatcgaactctatttaaacaagatctatctaggcaaccgcgcttacggagtt
gcagccgctgcccaggtatattacggcacgactctggataaacttgaattatcacaactg
gccatggtggcaggcttacccaaagctccctcccgttacaatcccctagcaaacccggag
cgagccttactacgaaggaactacgtgctccgacgcatgcatgaagttggttacatagat
gataaaacctaccaaaatgccgtggcccaaccgattacggcaaaattccatggcttaccc
gtcgaactagaggccccttttgtggcagaaatggcgcgaagtcaattgtttgaggaatac
ggcccagatatttatacggccggttataacgtttatacgactatcaaggctgaacatcag
gaagccgcgactaacgccttacgctccgcactgcttgcttatgatcaacgacatggcttt
cgggggacaaaacagcaggttgagttaccggaaggggctgatgaggcattttatcgtcag
gtcctatcccaatacagaatagccaacggcttagtgcctgccctggtgcttgctactgag
gagcaaaccagccaggtctacaccaaaactgatggtgaagttctcctttcttgggagggc
ttatcttgggcccgtccttatctaggcgttaacgccctagggaaaaaaccaaaacaagct
gcggatattctccaggcgggagatctcattcgactagaagcgctacctgaaggggggtgg
cgattagcgcaaacaccccaagtggagggtgccattgtctccctttcccctgataatggg
gggatcaccgccctcagtgggggcttcgatttttatcgaagcaaatttaatcgggcaatt
caatctcaacggcaacccggatccagtttcaagccatttctctattcctctgccctaaat
aaaggctataccgctgccagcgttatcaatgatgcaccgatagtattagatgaacctggg
ctagagaatgtctggcggccagagaactatagcggacgtttttacggcccgacccgcctc
agggtagctttaatccattccagaaatctggtttctgtccgattactgcgtgccatcggc
attgattatgccatcgaatatatccaacgttttggatttgaaccggaacaattaccccag
agcttatccctagcactaggcagtggtagtgcttctccccttgaaatggcccgtggcttt
gccgtcttcgccaacgggggacatctcatcaaaccccatttgattgaacgaattgagaac
gccaatgggcaaatcatcttccaagcacgctctccccaagtttgtcaacattgcgaagaa
ctggaagcagaacaagcccctatccccaacctaacatcgcttcctctccaagatgccaaa
cttatcagccagcctctcccagccccgcaggtaatcacccctcaaaatgcttatcttatc
tatagcatgctacaagacgttattcgccacggcacagggagacgggctaaacaactcgga
cgaaatgatctagcaggtaaaacaggaaccaccaatgatcaacacgatgcttggttttca
ggttttaattcggaactcgttgctgtctgctgggtaggctttgatcaaccgaagtcctta
ggaagcttcgaaacgggcgcacgggcagcacttccaatgtggataaattatatggatgcc
gtgcttgacggcgaaccagaaaaaccgcttatccccccgaagggcatcgttacggtgcgc
attgatcctgaaactggattgcttgcaaggcccaatacccctaatgctatttttgagact
tttctcgccgagcatgctcctgtcaagtacgccacctcaagccgccagagcgacagcagc
gcgaaaacagacacacctattaccgagcagctattttaa

DBGET integrated database retrieval system