KEGG   Neorickettsia helminthoeca: NHE_0045Help
Entry
NHE_0045          CDS       T03076                                 

Gene name
fabI
Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
nhm  Neorickettsia helminthoeca
Pathway
nhm00061  Fatty acid biosynthesis
nhm00780  Biotin metabolism
nhm01100  Metabolic pathways
nhm01130  Biosynthesis of antibiotics
nhm01212  Fatty acid metabolism
Module
nhm_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:nhm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    NHE_0045 (fabI)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    NHE_0045 (fabI)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    NHE_0045 (fabI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:nhm01004]
    NHE_0045 (fabI)
Enzymes [BR:nhm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     NHE_0045 (fabI)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     NHE_0045 (fabI)
Lipid biosynthesis proteins [BR:nhm01004]
 Fatty acid synthase
  Component type
   NHE_0045 (fabI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short DUF5625
Motif
Other DBs
NCBI-ProteinID: AHX11020
UniProt: X5HL13
LinkDB All DBs
Position
39685..40485
Genome map
AA seq 266 aa AA seqDB search
MLEGKLGLILGIANDRSIAYSIGKICNENGANLILTYPVDQFKKRLVPIAEEFGGAELVC
CDVSKEEGIAGLFHIIAEKYGKLDFIVHSVAFSDKEELQGEYINTSLANFLNSMHISCYS
LTAICRYALPLMKENGGSVLTLSYYGAEKVIPHYNVMGVCKAALEASVKYLSVDLGKYSI
RINTISAGPIKTLAASAIGKFSYILKWSKHNSPIKRNTTKEDVAGAALYFLSDLSSGTTG
STLHVDCGYHVVGMRAVDLPEDIMDV
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgttagaaggaaaattaggattaatactcggtatagcaaatgaccgctcaatcgcctac
tccatagggaaaatctgcaacgagaatggtgctaacttgatacttacatatccagttgat
cagtttaaaaagcgcttagtccctatagcagaggaattcggtggtgctgaactcgtgtgc
tgtgatgtctctaaagaagaaggaatagcaggacttttccatatcatcgcggaaaaatat
ggtaagttagattttatagttcactctgttgctttctcggataaggaagaactccaaggc
gaatacataaatacttcgcttgcgaacttcttgaattctatgcacatttcatgctactcg
ctgacagcgatttgcaggtatgccctgccattgatgaaggaaaatggtggtagcgtcctt
acattatcgtattacggcgctgaaaaagtcattccacactacaatgtgatgggtgtctgt
aaggcagcactcgaagcaagcgtcaagtatctgtctgtcgatttgggtaaatatagcatc
agaataaatactatctctgctggcccgattaagactcttgctgcttcagcgattggaaaa
ttctcctacatactaaagtggagtaaacacaattcccccataaaaagaaataccactaag
gaagatgtcgcaggtgcagccttatactttttgagtgacctaagcagcgggactacaggt
agtaccctgcacgtcgactgtggataccatgttgttggtatgagagccgtcgacctcccc
gaggatattatggacgtctaa

DBGET integrated database retrieval system