KEGG   Neorickettsia helminthoeca: NHE_0668Help
Entry
NHE_0668          CDS       T03076                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase family protein
  KO
K01286  D-alanyl-D-alanine carboxypeptidase [EC:3.4.16.4]
Organism
nhm  Neorickettsia helminthoeca
Brite
KEGG Orthology (KO) [BR:nhm00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    NHE_0668
Enzymes [BR:nhm01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     NHE_0668
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 Beta-lactamase2 Peptidase_S13
Motif
Other DBs
NCBI-ProteinID: AHX11601
UniProt: X5H4V9
LinkDB All DBs
Position
629955..630809
Genome map
AA seq 284 aa AA seqDB search
MLLSLKNLLLMICLISSSSLAHCTSAIAIDQKTGGVLVKEKADEVLYPASLTKMMTAYIV
FDHLKKKSLKWNQKLYVSESAASKAPSKLGLKPGEYVSLKDALLTMVMKSANDSATVLAE
KIGGSEENFAKMMTKKARSFGMRNTRFRNCTGLHAIDHVSTASDMAILARRVINDFPEYT
HIFGLKSFKYKDEWIHNTNKLLHSSPEIAGIKTGYTNYAGYNLASLAYRKGKRVITIVMH
APTSDERYEKSQELIDRAFANMRLQVSAPKLSHKYTNLNAHQSI
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgttgctgagtcttaaaaatctactcttgatgatttgtctcattagctcttctagtctt
gctcactgtacatcagcgatcgctatagaccagaaaacaggtggagttctagtaaaggaa
aaggcagatgaagtgctatatccagcgtcactgacaaaaatgatgactgcgtatattgtg
ttcgaccatcttaaaaagaagtcgctaaaatggaatcagaaactttacgtttccgagagt
gctgcatccaaggccccttcaaagctgggattaaaaccaggtgaatacgtgagcctcaaa
gatgcgctcctcacaatggtaatgaaatcagcaaatgactcagcgacagtgcttgcggaa
aaaataggtggttcagaagaaaactttgcaaaaatgatgacaaaaaaagccagatccttc
ggaatgaggaatactcgtttcaggaactgcactggactccacgctatagatcatgttagt
acggcaagtgatatggcaatactcgcaaggagagtcatcaatgatttcccggagtacaca
cacatatttggattaaaatctttcaaatacaaagatgagtggatccataacacaaataag
ctcctacatagtagtccggagatagctggaataaagacaggatatacaaactatgcagga
tataacttggcttccttggcctataggaaggggaaaagagtcataacaatcgtcatgcat
gcccctacatcggatgaaagatatgagaaatctcaggaactcatagatcgggcatttgca
aatatgagactgcaagttagtgctccgaaattatcgcataaatacaccaatctcaatgcg
catcaaagtatttga

DBGET integrated database retrieval system