KEGG   Niabella ginsenosidivorans: A8C56_01010Help
Entry
A8C56_01010       CDS       T04418                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
nia  Niabella ginsenosidivorans
Pathway
nia00620  Pyruvate metabolism
nia00680  Methane metabolism
nia01100  Metabolic pathways
nia01120  Microbial metabolism in diverse environments
nia01200  Carbon metabolism
Module
nia_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:nia00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    A8C56_01010
  09102 Energy metabolism
   00680 Methane metabolism
    A8C56_01010
Enzymes [BR:nia01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     A8C56_01010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 RasGEF_N
Motif
Other DBs
NCBI-ProteinID: ANH79742
UniProt: A0A1A9HZ86
LinkDB All DBs
Position
219099..221678
Genome map
AA seq 859 aa AA seqDB search
MDVVASQSVQRFKNDVGVRFQLYNSLFTSLPFHKIEKTGILLSLLSNMCEEGYEKGLSPV
EILEDFFSRHTSFTTPRERLDLLFRLVQYVERQVVLFDALEDASYKKINDFNGPGTLKQL
MSAVAQNNKEAQLDKVLEDFCVRLVLTAHPTQFYPGSVLGIIRDLSNALVKNDASEINTL
LQQLGKTPFFKKNKPTPFDEAVSLIWYLENVFYPAAGRILSELKNQFPDVATDKHTLIKM
GFWPGGDRDGNPFVTTDTTLQVAAALRAAILKCYYFDVRRLKRRLTFHDVEDIMSDLERR
LYEEVFIPGHEAKITDKEIISILEGVKKIVNERANGLFVSRIQDLISKIEIFGLHFASLD
IRQDSSIHEKVFSQVAASQSGILPENYDDLGEKEKVKLLLNLKPLGASSIFKDDVVRDTV
EVVNAICSIQKSNGEQGCNRYIISHATSVLSIIEVIGLFKLNGISSQEMNVDIVPLFETI
DDLQNAGDIMKTLYSLPEYKAHLGRRGKTQTIMLGFSDGTKDGGYLMANWCIYRAKEELT
RITRQYGFDVIFFDGRGGPPSRGGGKTHKFYASMGRNISNKEIQLTIQGQTVSANFGIID
SAQFNIEQLINAGVSSSLFSDRYPPLNGKQEQLLQELSSYGFDAYIKLKNHPQLANYLYE
ISPLRFYSETNIGSRPAKRGKQTSISLGDLRAIPFSGAWSQLKQNVPGFFGVGTALKQME
YIGRFDELKQLYNDSLYFKTLLDNCEMAMSKSYFPITAYIAKDQQFGDIWKMIYDEFVLT
KQYIYKLTGHDTLMASYPVDKLSIRMRERIVMPLVTIQQYALVQLREGNDDKEESLHEVL
GKLVMRCSFGIINAGRNSA
NT seq 2580 nt NT seq  +upstreamnt  +downstreamnt
atggatgtggtagcgagtcagtccgttcagcgctttaagaatgatgttggcgttcgattt
caattatacaatagtttatttacttctttaccctttcataaaattgaaaagaccgggatt
ttattatcactgctgtccaatatgtgtgaagagggctatgaaaaagggctgagccctgtc
gaaattctggaagatttttttagccggcacacttcttttaccacgcccagggagcggctg
gatctattgttccggctggtgcaatatgtagagcgccaggtggttttatttgatgcactg
gaagatgcctcctataaaaaaataaatgactttaatggccccggtacgttaaaacagctg
atgtctgcagtagctcaaaataacaaggaggctcagttggataaagtgctggaagatttt
tgcgtgcggttggtgctaacagcgcatcctacccagttttatccgggttctgtgctgggt
attatcagggacctgagcaatgccctggttaaaaatgatgccagtgaaataaatacactg
ttacagcagttgggtaaaacgcctttttttaaaaaaaacaaacccacgccttttgacgaa
gcggtaagtcttatctggtatcttgaaaatgttttttatccggcagcaggccgtattctc
agcgagttaaaaaaccagttcccggatgttgctacagacaagcatacactcataaaaatg
ggcttttggcccggtggcgacagggatggaaatccttttgttactactgataccacgctg
caggtagctgcggcgctacgcgcggctattttgaaatgctattactttgatgtgcgcagg
ctaaaacgccggctgacttttcatgatgtagaagacattatgagcgatctggaacgccgc
ctgtatgaggaggtattcattccggggcatgaagccaaaataaccgataaagaaattata
tccatactggaaggggtaaagaaaatcgttaatgagcgggccaacgggttatttgtgtcc
cggatacaggacctgatcagcaaaattgaaatattcgggctgcattttgcatcgctggat
ataagacaggacagctctatacatgaaaaagtattttcacaggtagcagcttcacagtcg
ggcatattgccggagaattacgatgacctgggagagaaggaaaaggtgaaattactgttg
aaccttaaaccgcttggcgcttcttccatattcaaagatgatgttgtaagagatacggtt
gaagtcgtaaacgccatttgttctatacaaaagtcgaacggggaacagggctgtaaccga
tatattatcagccatgccaccagtgtactgagcattatagaagtaattggtttgtttaaa
ctgaacggcatcagcagccaggaaatgaatgtggatattgttccgctttttgaaacaatt
gatgatctgcaaaatgcgggggatattatgaaaaccctgtattcccttccggaatataag
gcacatctgggccgccgtggcaaaacgcaaaccatcatgctgggcttttctgatggtacc
aaagatggcggctacctgatggccaactggtgcatttaccgggcaaaggaagagctgacg
cggatcacaaggcaatacggctttgatgttattttctttgatggaagaggggggcctcct
tcccgcggtggcggaaaaacacataagttctatgcctctatgggacggaatatttctaac
aaagaaattcagctgaccatacagggccaaaccgtaagcgctaatttcggtattattgac
tctgcccagtttaacatagagcaattaattaacgctggtgtgtccagctcccttttttcg
gatcgctatccgccgttaaacggcaagcaggagcagttattgcaggagctttcttcatac
gggtttgatgcgtatataaaactgaagaaccatccgcaactggccaattatttgtatgaa
ataagccccctgcgtttttacagcgaaacaaatattggcagccggccagccaaaaggggc
aaacagacttctatttcactgggcgatttacgtgcgattccgttctcgggtgcgtggagc
cagctgaagcaaaatgtgcccggtttctttggtgtgggcactgcgttaaaacaaatggaa
tatatcgggcgctttgatgaactgaagcaattatataacgactcgctgtactttaaaacc
ctgctggataattgcgaaatggccatgagcaaatcttatttccccataacggcttacatc
gcaaaggatcagcaatttggtgatatctggaaaatgatttatgatgaatttgttttaacc
aagcaatatatttataaactaacgggacatgatacattaatggcctcttatccggtagat
aaattatccatccgcatgcgtgagcggatcgtgatgccgctggtaactattcaacaatac
gccctggtgcaattgcgtgagggtaatgacgataaagaagaaagcctgcacgaagtgctt
ggaaaactggtgatgcgctgctcctttggaattattaatgccggaaggaattcagcataa

DBGET integrated database retrieval system