KEGG   Niabella ginsenosidivorans: A8C56_04000Help
Entry
A8C56_04000       CDS       T04418                                 

Definition
(GenBank) glycoside hydrolase
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
nia  Niabella ginsenosidivorans
Pathway
nia00052  Galactose metabolism
nia00511  Other glycan degradation
nia00600  Sphingolipid metabolism
nia01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nia00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    A8C56_04000
  Lipid metabolism
   00600 Sphingolipid metabolism
    A8C56_04000
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    A8C56_04000
Enzymes [BR:nia01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     A8C56_04000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_2_C Glyco_hydro_2_N DUF4982 Glyco_hydro_2 BetaGal_dom4_5 Big_1 Big_2
Motif
Other DBs
NCBI-ProteinID: ANH80259
UniProt: A0A1A9HZL4
LinkDB All DBs
Position
937859..940249
Genome map
AA seq 796 aa AA seqDB search
MKHVLLLIGMVMNVLMVSAQRTTIDFNKGWKFMLADATSYKNTDFNDAAWRRLDLPHDWS
IEGRFNAANPAGNAGGALPGGVGWYRKTFSLPETGEQRRVYLQFDGIYRNSEVWINGQYL
GKWPYGYTAFQYELTSYLKKGNQKNVIAVRVDNAQQPNSRWYSGSGIYRDVRLVITRQVA
LEHWGVFVTTPEVTRGRALVNVAATLHEAVPVPVLIVNKIYDSKGVLVAHSNARLATQER
VSLQKLPVNNPELWSVDHPALYRLVTQVYAGALLTDTDTTSFGIRYFNFNAKSGFSLNGD
HLKIQGVCLHHDLGALGAAFNRSAARRQLQRLKDMGCNAIRTAHNPPAAAFLDLCDEMGF
LVMDESFDMWAKKKNKYDYSGDFLKWHQRDLEHMVKRDRNHPAVFIWSIGNEIREQFDST
GITLAKELVHIVKSLDTTRPVTCALSENDPAKNFIYQSKALDVVGLNYHIEAYEDFPKNF
PDEKFIATENVSGLATRGHYDLPADSLRYWPPSSKFKYVPEGNADYTVSAYDNVAAYWGS
THEQTWRIIKKHDYLSGLFVWSGFDFLGEPVPYPYPARSSYYGIIDLAGFPKDVYYMYQS
EWTKKTVLHIAPHWNWRKGQNVDVKIYYNNADEVELFLNGRSLGKKTKPDTAFHVLWKVP
YEPGMLKAVSYKKGSRVLERTIRTAGTPARIEATVENPNIRLAANELAYITIRILDREGN
LVPDAGNEVAVTTGANAEVIAMDNGYQADQEPFRAPQRKAYNGMALAIVKGLKKGTATIT
VTAKGMQRATVSVSIQ
NT seq 2391 nt NT seq  +upstreamnt  +downstreamnt
atgaagcatgtattgttgttgataggtatggtaatgaatgtgctgatggtttcggcccaa
cgcacaacaattgattttaataagggatggaaatttatgctggcggatgctaccagctat
aagaacacagattttaatgatgctgcctggcgccggctggatctgccgcacgactggagc
attgaagggcgttttaatgctgccaacccggccggtaatgcaggtggtgctttgcccggt
ggtgtgggctggtaccggaaaaccttttcattgccggaaaccggtgagcagcgcagggtg
tatctgcaatttgatggtatttaccggaacagtgaagtatggatcaacgggcaatacctg
ggcaaatggccttatggctatacggcattccagtatgaattaacctcctatctgaaaaaa
ggaaatcagaaaaatgtgatagccgttcgggtagataatgcacagcagccaaattcacgc
tggtacagcggctccggcatttacagggatgtacggctggtgatcacccgccaggtagcg
ctggaacactggggcgtttttgtaaccacaccggaagttacccggggcagagcgctggta
aatgttgcagccacgttgcacgaagcggtaccggtgcctgtcctgatcgtcaataaaatt
tatgacagcaaaggggtgctggttgcgcactccaatgcaaggctggcaacacaggaacgc
gtttccctgcaaaagctgcctgtcaataacccggaattgtggtctgttgatcatccggcg
ctgtacaggctggtcacccaggtgtatgcaggggcgctgcttacagacactgataccact
tcttttggtatccgttatttcaattttaatgcaaagagcggattctccttaaacggtgat
cacctgaaaatacagggtgtgtgcctgcaccacgacctgggtgcattgggcgctgcattt
aaccggtctgccgcacggcggcaattgcagcgcttaaaggatatgggttgtaatgcgatt
agaaccgctcacaacccgcctgccgctgccttcctggatctttgtgatgaaatgggcttc
ctggtgatggatgagtctttcgacatgtgggcgaagaaaaagaataagtatgattactcc
ggtgattttttaaaatggcaccagagagacctggagcatatggtaaagcgggatcgcaat
catcctgctgtttttatatggagcatcgggaatgaaataagagaacagtttgacagcacg
ggcataacacttgcaaaagaactggtgcatatcgtaaaatcgctcgataccacaagaccc
gttacctgtgcgctgagcgagaatgatcccgcaaagaattttatctatcaatccaaagcg
ctggatgttgtgggactgaattatcatattgaagcgtatgaagattttccaaaaaacttc
ccggatgaaaaatttatagccactgaaaatgtttccggcctggctacgcgggggcattat
gacctgcccgcagattcgctgcgttactggccgccttcctctaaattcaaatatgtgccg
gaggggaacgcggattatacggtatctgcttatgataatgttgctgcttactggggttcc
acgcatgagcagacatggcgcatcataaaaaagcacgattacctgtccggcttatttgtt
tggtcgggatttgattttctgggagaaccggttccctatccgtaccctgcgcgcagctct
tattatggcatcatagatcttgccggctttcccaaggatgtttattatatgtaccagagc
gaatggacaaaaaaaacggtgctgcatatagcgccgcactggaactggaggaaggggcag
aacgtagatgtaaaaatctattacaataacgccgatgaagtggaattatttttaaatggc
aggtcgctgggaaaaaaaacaaaaccggataccgctttccatgttttatggaaggtaccc
tatgagcccggcatgttaaaagccgtttcttataaaaaaggcagcagggtactggaaaga
accataagaacagccggtactcctgcgcggattgaagcaactgttgaaaacccaaacatc
cgcctggcagcaaatgagctggcatatataactatccggatactggatagagaaggaaat
ttagtgcccgatgccggtaatgaagttgccgttactaccggtgccaatgcagaagtgatc
gctatggacaatggctaccaggcagaccaggaacccttccgggccccgcagcgtaaggct
tacaacgggatggcgctggcgattgtaaaagggttaaaaaaaggtacggcaaccattaca
gttacagcaaaaggaatgcaaagggcaacagtgtccgttagtatacagtaa

DBGET integrated database retrieval system