KEGG   Niabella ginsenosidivorans: A8C56_04690Help
Entry
A8C56_04690       CDS       T04418                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
nia  Niabella ginsenosidivorans
Pathway
nia00010  Glycolysis / Gluconeogenesis
nia00020  Citrate cycle (TCA cycle)
nia00620  Pyruvate metabolism
nia01100  Metabolic pathways
nia01110  Biosynthesis of secondary metabolites
nia01120  Microbial metabolism in diverse environments
nia01130  Biosynthesis of antibiotics
nia01200  Carbon metabolism
Module
nia_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:nia00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A8C56_04690
   00020 Citrate cycle (TCA cycle)
    A8C56_04690
   00620 Pyruvate metabolism
    A8C56_04690
Enzymes [BR:nia01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     A8C56_04690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 PYNP_C DUF2118 GCV_H
Motif
Other DBs
NCBI-ProteinID: ANH80371
UniProt: A0A1A9I0X9
LinkDB All DBs
Position
1140518..1142152
Genome map
AA seq 544 aa AA seqDB search
MAEKILMPRLSDTMTEGVIADWHKKVGDPVKKGDLLAEIETDKATMELESYKDGVILYLG
APKGSKLQVDDLLAIVGEAGEDISGLVGGNGASSKEAASKPETQKEAAAPQQEAPKAEKK
PSADVSGMEEVVLMPRLSDTMTEGVIASWAKNVGDAVKKGDLLAEIETDKATMELESYKN
GTLLYQGAKKGEKIQVNDLLCIIGDPSKVDVDAIVAAVKGGGAAPATADAGSEAAPAAQE
TTAPAAEQPAAAQSASSADGRIKASPLAKKLAAEKGIDLSQVQGSGDNGRIIKSDIDNYK
PGAAAPAQPEIAAAPAGQVSFEDVPVSQMRKVIAKRLAESKFTAPHFYLTMQIDMDNAVA
SRARINETSPVKISFNDFVLKACAIALKKHPAINSSWLGDKIRTNHHINIGVAVAVEEGL
LVPVVRFADTKSLSQIAVEVKEFAKKAKDKKLQPSDWEGNTFTISNLGMFGIDEFTAIIN
PPDACILAIGGIAQVPVVKNGAVVPGNIMKVTLSCDHRVVDGAKGAAFLQTLKELLEEPL
RMLV
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atggctgagaagatattaatgccccgtttgagtgataccatgactgaaggggtgattgca
gactggcataaaaaagtgggtgatcctgttaaaaaaggcgacctgttggcagagatcgaa
acggataaagcaaccatggagctggaaagctataaagacggtgttattttatacctgggc
gctcccaagggctctaaattgcaggtggatgaccttttagccattgtgggtgaagccggg
gaagatatttcaggtcttgttggcggaaacggagcttcttcaaaagaagctgcctcaaaa
ccagaaacccaaaaggaggcggcagctcctcaacaggaggcccccaaagctgaaaaaaag
ccttctgctgatgtttccgggatggaagaagtagtgctgatgccccgcctgagcgatacc
atgactgaaggtgtgattgccagttgggctaaaaatgtgggagatgctgttaaaaaaggg
gatctgctggcggaaattgaaacagataaggccaccatggagctggaaagctataaaaac
ggaaccttattataccagggcgcaaagaaaggcgaaaaaatacaggtgaacgacctgctt
tgcatcataggggacccttcaaaagtggatgttgatgcaatcgtagcggccgtaaaaggc
ggcggggctgcaccggcaaccgccgatgccggaagcgaagcagcacctgcagcacaggaa
acaactgctcccgcagcagaacagccggcggcggcacagtccgcttcttctgcggacggg
cgcatcaaagcctctcctctggcaaaaaaactggcggctgaaaaaggaattgatctcagc
caggtgcagggaagcggtgataacgggcgtattataaaatcggatattgacaattacaaa
cctggtgccgcggcaccggcccagcccgaaatagctgccgcccctgccggacaggtgagc
tttgaggatgtaccggtttcccagatgcgtaaagtaattgcaaagcgtttggcggaaagc
aaattcactgccccgcatttctacctgactatgcaaattgacatggataacgctgtagcc
agccgcgcccggatcaatgagaccagccctgtaaaaatatcttttaatgattttgtttta
aaagcctgcgccattgcgttaaaaaaacatcctgccattaacagcagttggctgggcgat
aaaattcgtaccaaccatcacatcaatattggtgtggccgtagctgtggaagaaggtttg
ttagtgccggtggtgcgctttgctgatacaaagtcactgtcgcaaattgctgtagaggta
aaagagtttgccaaaaaagcaaaagacaaaaaattacagccatcggattgggaaggtaac
accttcaccatttccaacctgggtatgtttgggatagatgagtttacggcaattattaat
cctccggatgcctgtatcctggccattggcggtattgcacaggtacctgttgtaaagaac
ggggcagttgttcccggaaatataatgaaagttactttaagctgcgatcaccgggtggta
gatggcgccaaaggggcagccttcctgcaaacgctcaaagagctgctggaagagccttta
agaatgctggtttaa

DBGET integrated database retrieval system