KEGG   Niabella ginsenosidivorans: A8C56_05225Help
Entry
A8C56_05225       CDS       T04418                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
nia  Niabella ginsenosidivorans
Pathway
nia00020  Citrate cycle (TCA cycle)
nia00310  Lysine degradation
nia00380  Tryptophan metabolism
nia01100  Metabolic pathways
nia01110  Biosynthesis of secondary metabolites
nia01120  Microbial metabolism in diverse environments
nia01130  Biosynthesis of antibiotics
nia01200  Carbon metabolism
Module
nia_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nia_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:nia00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A8C56_05225
  09105 Amino acid metabolism
   00310 Lysine degradation
    A8C56_05225
   00380 Tryptophan metabolism
    A8C56_05225
Enzymes [BR:nia01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     A8C56_05225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N HsdM_N PFOR_II
Motif
Other DBs
NCBI-ProteinID: ANH80470
UniProt: A0A1A9I172
LinkDB All DBs
Position
1263070..1265826
Genome map
AA seq 918 aa AA seqDB search
MKDFSYITSSSPEFIENMYKEFVKNPENVDTELKKFFEGFDFAIGNGLAEKNGTTRAAGS
STLATPGTDWRKEIAVYRLILGYRNKGHLLADTNPIKKRKDRGANLDLPFFGLSEEDLDN
EYEAGSLIGLGTTPLRNILSHLKKCYAGHVGIEFKYISDQKKVDWLTNEMEKKFTNPLPL
EQKKRILEKLNEGVMFEKFLHTKYVGQKRFSLEGGETTIPALDAIINKGAELEVKEVVIG
MAHRGRLNVLANILGKTYEQIFSEFEGTGEINQTMGSGDVKYHLGYGSVIEAANGEKVHL
KLMPNPSHLEAVDPVVLGFARSSANILHNERYESVLPILIHGDAALAGQGVVYELLQMSK
LNGYYTGGTIHFVINNQIGFTTDFSDARSSDYCTSLAAIVQSPVLHVNGDDPEAVVKCAE
IAMRYRNEFHADVFIDMVCYRKHGHNEGDDPKFTQPTMYALIDKHPNPREVYIKYLLDKG
EEDTKELAKEMEKKFWDDLQDRLDEVKQHPLPYTYQDPELQWKSLRKATALDFEKSPDTA
ISGEHFKTIFDALMKIPDGFTPLRKVAKLLQDKVKLLETEQKVDWATGELMAFGSLLLDG
SDVRMSGQDVGRGTFSSRHAVLRDEVTDAAYNRLSGLPGSTAKFRIYNSLLSEYAVLGFE
YGFALATPNVLVVWEAQFGDFANGAQTLIDQFITSAEQKWNRMDGLVMLLPHGFEGQGPE
HSSARIERFLQSCAELNIVVTNITTAANYFHALRRQLKWPFRKPLINFAPKANLRHPGSY
SLKEEFTNGRFREVIDDAFADDPVTVKTVLFCSGKIYFDLAEKQVKDNRKDVAVIRMEQL
YPLPKKQLDDLYAKYKNAVWYWVQEEPLNMGAASFLQMNLKDINYGIIGRKPSAAPASGF
MKVHKAEQEEIINTAFSM
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatttttcatacattacaagctcctctcctgagtttatagaaaatatgtacaag
gagtttgtaaaaaacccggaaaatgttgatactgaattaaaaaaattttttgaaggattt
gattttgccatcggcaatggcctggcagaaaagaacggaacaaccagggctgccggcagc
agcacattagctaccccgggaactgactggagaaaagagatcgccgtataccggctaata
ctgggctacaggaataaaggtcatttgctggcagataccaaccctattaaaaaaagaaag
gaccggggcgccaatcttgatcttccttttttcggactgtcagaagaagatctggacaat
gaatatgaagccggcagcctgatcggcctgggcactaccccgctgcggaatatactgtcg
catcttaaaaaatgctatgcaggtcatgtaggtatcgagttcaaatatatcagtgatcag
aaaaaggtagactggctgaccaatgaaatggaaaagaaatttaccaatccgttaccgctg
gaacaaaagaaacggatccttgaaaagctgaatgaaggggtgatgtttgaaaagttcctt
cacaccaaatatgtggggcagaaacggttttccctggaaggtggtgaaacaaccattccg
gcgttggatgctattattaataaaggagcagagctggaggtgaaagaagttgtgatcggt
atggctcaccgcggccgcttaaatgtgctggcaaatattctgggtaagacatatgagcag
atctttagcgaatttgaaggcacgggagagatcaatcagaccatgggcagcggtgatgtg
aagtatcacctggggtatggaagtgttatagaagctgccaatggcgaaaaggtgcatttg
aagctaatgcccaatccttcgcacctggaagctgtggacccggttgtgctgggctttgca
agaagcagtgccaatattttacataatgagcgttatgaaagtgtattgcccatattgata
catggggacgccgcactggcagggcagggcgttgtttatgagttattgcagatgtccaaa
ctgaacggatattatacaggcggtaccattcattttgtcatcaataaccagatcggtttt
acaactgatttttctgatgcgcgcagctcagattattgcacatcgctggcagcaatcgtg
cagtcgccggttttacacgtgaacggagacgatccggaagccgttgtaaagtgcgcggaa
atagccatgcgctacaggaacgagtttcatgcggatgtgtttattgacatggtgtgctac
cggaaacatgggcataatgagggagatgatcccaaatttacacagccaacgatgtacgcc
cttattgacaaacatcccaatccccgggaagtgtatataaaatatttactggataagggt
gaggaagataccaaggaactggcaaaggaaatggagaaaaagttctgggacgacctgcag
gaccgcctggatgaagtaaagcagcatccgttgccctatacttatcaggatccggaactg
caatggaaaagcctgcgtaaagctactgcgctggattttgaaaaaagcccggataccgca
atcagcggggagcacttcaaaacaatctttgatgcacttatgaagatccccgatgggttt
actcctttaagaaaagtagccaagctgcttcaggataaagtaaaactgctggaaaccgaa
caaaaagtggattgggcaaccggtgaattaatggcttttggttccctgctgctggatggc
tctgatgtgcgcatgtctggccaggatgttggccggggtacttttagttcccgccatgcc
gtgctgagagatgaagttacggatgctgcctataaccgtttgagcgggttacccggctcc
acagccaaattcaggatctataactcactgttaagcgagtatgccgtactgggctttgaa
tacggttttgcactggcaacccctaatgtgctggttgtatgggaggcacagttcggtgat
tttgcaaatggcgcccagaccctgatcgatcagtttattaccagcgctgagcaaaaatgg
aaccgtatggacggattggtaatgctgctgccgcacggttttgaagggcaggggccggag
cacagcagtgcgcggattgaacgctttttacagtcctgtgctgagctgaatattgtggtg
accaatatcactacggccgccaattatttccatgcgctgcgccgccagcttaaatggcct
ttccgtaaaccactgatcaactttgcacctaaagccaatctcaggcatccgggcagctat
tcattaaaagaggagttcacgaacggccgtttccgggaggtgatcgatgatgcgtttgca
gacgatcctgtaacagtaaaaacagtgttgttctgttccggtaagatctattttgatctt
gctgaaaaacaggtgaaggataaccgtaaggatgttgctgttattcgtatggagcaattg
taccccctgcctaaaaaacagctggacgacctgtatgccaaatacaagaatgctgtttgg
tactgggtacaggaagaaccgctgaatatgggtgcggcctccttcctgcaaatgaacctg
aaagatatcaattatggtatcattggccgtaaaccaagcgcggcacctgcttccggattt
atgaaagtgcataaagcagagcaggaggagatcattaatacagctttttcaatgtaa

DBGET integrated database retrieval system