KEGG   Niabella ginsenosidivorans: A8C56_08230Help
Entry
A8C56_08230       CDS       T04418                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
nia  Niabella ginsenosidivorans
Pathway
nia00020  Citrate cycle (TCA cycle)
nia00480  Glutathione metabolism
nia01100  Metabolic pathways
nia01110  Biosynthesis of secondary metabolites
nia01120  Microbial metabolism in diverse environments
nia01130  Biosynthesis of antibiotics
nia01200  Carbon metabolism
nia01210  2-Oxocarboxylic acid metabolism
nia01230  Biosynthesis of amino acids
Module
nia_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nia_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:nia00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A8C56_08230
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    A8C56_08230
Enzymes [BR:nia01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     A8C56_08230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ANH80969
UniProt: A0A1A9I1N8
LinkDB All DBs
Position
complement(1969683..1970915)
Genome map
AA seq 410 aa AA seqDB search
MAQKIKVANPVVELDGDEMTRIIWKFIKDKLILPYIDVDIKYFDLGIEHRDATNDQVTID
AANAIKEHGVGIKCATITPDEARVKEFNLKQMWKSPNGTIRNILDGTVFREPIVISNIPR
LVTNWTAPIIVGRHAFGDQYRATDTVIKGKGKLTMTFTPEDGGEPQTFDVYNFKGDGVAM
TMYNTDESIKGFARSCFNMALSKKWPLYLSTKNTILKKYDGRFKDIFQEIYENEFKAEFE
NAGITYEHRLIDDMVASALKWNGNFVWACKNYDGDVQSDTVAQGFGSLGLMTSVLVTPDG
KTLEAEAAHGTVTRHYRAHQQGKPTSTNPIASIFAWTRGLAFRGKLDGNQELIDFANKLE
AVCIETVEQGKMTKDLAVCIHGNKVEHGKDYLYTEEFLEAIDENLQKKLN
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggctcagaaaattaaagttgccaaccctgttgtggaactggatggggatgaaatgacc
agaattatatggaaattcattaaagacaaattgatccttccttatattgatgtggatata
aagtatttcgatttaggcatcgagcaccgcgatgcaaccaatgaccaggttacaattgac
gccgcaaatgctattaaggaacatggagtgggcattaagtgcgcaacgatcactcccgat
gaagcgcgcgtaaaagagttcaatttaaaacaaatgtggaaaagccctaatggcactatc
cgcaatatccttgatggcactgtattccgtgagccgatcgtgatcagcaacataccacgg
ctggtgaccaactggaccgctcctattattgtgggccggcatgccttcggagaccagtac
cgcgctacagatacggtgatcaaaggaaaaggcaaactgaccatgacttttaccccggaa
gacggaggcgagccgcagacctttgatgtatacaacttcaaaggcgacggtgtggccatg
accatgtacaatacggatgaaagcattaaaggttttgcaagaagctgtttcaatatggcg
ctcagcaaaaaatggccattgtacctttctacaaaaaataccatccttaagaaatatgac
ggccgctttaaagatattttccaggaaatttatgaaaatgaatttaaggcagaatttgag
aacgcgggcataacctacgaacaccggctgattgatgacatggtggccagcgctttaaaa
tggaacggcaattttgtttgggcctgcaaaaactatgacggcgatgtgcagagcgatact
gtagcccagggctttggttctttaggcctgatgacttctgtgctggtaacccctgatggt
aaaacgctggaagccgaagcagcgcacggaaccgtaacgcgccattaccgcgcccatcag
caagggaagcctaccagcaccaaccctatcgcaagtatttttgcatggaccaggggcctg
gcttttcgcggaaagctggatggcaaccaggaactgatcgattttgccaataagctggaa
gcggtttgtattgaaaccgttgagcagggcaaaatgaccaaagaccttgcggtttgcatc
cacggtaataaagtggagcatggtaaagattatttatataccgaagaattcctggaggca
attgatgagaacctccagaagaaattaaattag

DBGET integrated database retrieval system