KEGG   Niabella ginsenosidivorans: A8C56_11610Help
Entry
A8C56_11610       CDS       T04418                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
nia  Niabella ginsenosidivorans
Pathway
nia00240  Pyrimidine metabolism
nia01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nia00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    A8C56_11610
Enzymes [BR:nia01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     A8C56_11610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK
Motif
Other DBs
NCBI-ProteinID: ANH81535
UniProt: A0A1A9I2H5
LinkDB All DBs
Position
2797149..2797718
Genome map
AA seq 189 aa AA seqDB search
MFIEPNLTGERRGWIEVICGSMFSGKTEELIRRLKRVQFANLKAEIFKPAIDTRYDEEHI
VSHDTNVIHSTPVDNSQKILLLGQSVDVIGIDEAQFFDAELPDVCDQLAYKGIRVIVAGL
DMDYTGKPFGRMPDILARADYITKLHAICVKCGNIANYSYRKIPDDDQIMLGATDAYEPR
CRKCYFDKV
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgtttattgaaccgaaccttacaggagagcggcgcggatggattgaagtgatctgtggt
tccatgtttagcggaaaaacggaagagctgatcaggcggttaaaacgggtgcagtttgcc
aacctgaaagcggaaatatttaaaccggccatagatacccgttatgatgaagagcatatt
gtttcacatgatacaaacgtcattcactcaacaccggtagataattcacagaaaatactg
ctgctgggccagagcgtggatgtgatcgggattgatgaagcgcagttttttgatgccgag
ctgcccgatgtttgcgatcagctggcctataagggaatcagggtgatcgttgcggggctg
gatatggattataccgggaagccttttggccggatgcccgatattcttgcaagagcagac
tatattacaaagctgcacgcgatctgtgtgaaatgcgggaacattgccaattactcttac
cgtaaaattccggatgacgaccagatcatgctgggcgcaacagacgcgtatgaaccccgt
tgcaggaaatgctattttgataaagtctaa

DBGET integrated database retrieval system