KEGG   Niabella ginsenosidivorans: A8C56_18670Help
Entry
A8C56_18670       CDS       T04418                                 

Definition
(GenBank) hypothetical protein
  KO
K08138  MFS transporter, SP family, xylose:H+ symportor
Organism
nia  Niabella ginsenosidivorans
Brite
KEGG Orthology (KO) [BR:nia00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:nia02000]
    A8C56_18670
Transporters [BR:nia02000]
 Major facilitator superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    A8C56_18670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sugar_tr MFS_1 MFS_2 MAP17
Motif
Other DBs
NCBI-ProteinID: ANH82729
UniProt: A0A1A9I6Q2
LinkDB All DBs
Position
complement(4418974..4420296)
Genome map
AA seq 440 aa AA seqDB search
MKTYLVLVCLVAAAGGFLFGFDTSVISGVIEYLVPKFELNEIQKGWTVACILVGCMIGSG
LSGRISTKYGRKKALMFAAVIFFISSLGCAFSNTYMVFIVNRLIAGISVGAASTLAPVYI
AEISPARHRGKLLTLNLIAIILGQTAAFFSNYALQQVGGTDNWRWMIGIMAAPSVLFLVF
LFFVPESPRWLVEKKRDKEALLVLERLNTKAVAQSVITEIKDSLKSSPTIKPGALFKGTI
LKILVVGCLLAVFQQVTGINIIMYFAPSIFKAADFGQSAALFQTAIIGVVYLIASLLAFL
FIDRIGRKPLMIAGSIGMGISLIFLALTFVTKHTGGSWVMFCIMGFIASFGFSLGPVVWV
LIPEIFPNQYRSEGVALSVFVMWVANFLVTVTFPILLKEMQGYAFFIYAAMCILSALFSV
TMLRETKGKTLEELEELYEK
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacttatttggttctggtatgcctggttgcagcagcaggcgggtttctttttgga
tttgatacctctgtcatttccggcgtcattgagtatctggtgccgaaatttgaattaaat
gaaattcaaaaggggtggacggttgcctgtatattggttggttgtatgatcggcagtggt
ctttccgggaggatcagtacaaaatatggccggaaaaaggccctgatgtttgccgctgtt
attttttttatctcttctttgggctgcgctttttcaaatacgtatatggtgtttatcgta
aaccggctgattgccggtatttctgtaggagccgcttccaccctggccccggtatatatt
gcggagatatcgccggccaggcacaggggaaaactattgacccttaacctgattgcgatc
atcctgggtcaaaccgctgccttcttttccaattatgccttgcagcaggtgggcggaacc
gataactggagatggatgatcggaataatggctgccccttcagtgctctttctggtgttc
ctgttctttgttccggaaagcccccgctggctggtggaaaagaaaagggataaagaagcg
ctgttggtacttgaacggctgaatacaaaagctgtagcgcaatccgtaattacagaaata
aaggattctttgaaatcttcgcccactattaaaccgggcgcgctgttcaaaggaaccatt
ttaaagatccttgtagtaggctgccttttagctgtttttcagcaggtcacgggtataaac
atcattatgtattttgcaccgtctattttcaaggcagctgattttggtcaaagcgccgct
ttattccaaactgcaataattggcgtggtctatctgattgcttcgctgctggctttttta
tttattgaccggatcggccggaaaccattaatgattgctggttccattggcatgggaata
tcccttatttttttggcgctgacttttgttacaaagcataccggaggatcctgggtaatg
ttctgcattatgggctttattgcttcctttggcttttcgctgggtcctgttgtttgggta
ctcattccggaaatatttcctaatcaatacaggagtgaaggggtggccctttctgttttt
gttatgtgggtcgctaactttttggttacagtcactttccccatcttattaaaagaaatg
cagggctatgcattctttatctatgccgctatgtgtatattatctgcgctgttctccgtt
accatgctaagggaaacaaaaggtaaaacacttgaggagttagaggagctatatgaaaaa
tga

DBGET integrated database retrieval system