KEGG   Niabella ginsenosidivorans: A8C56_21560Help
Entry
A8C56_21560       CDS       T04418                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
nia  Niabella ginsenosidivorans
Pathway
nia00564  Glycerophospholipid metabolism
nia01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nia00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    A8C56_21560
Enzymes [BR:nia01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     A8C56_21560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored GIDA Pyr_redox_2 HI0933_like NAD_binding_8 Lycopene_cycl FAD_binding_3 Pyr_redox_3 Pyr_redox
Motif
Other DBs
NCBI-ProteinID: ANH83218
UniProt: A0A1A9I6B5
LinkDB All DBs
Position
5104036..5105598
Genome map
AA seq 520 aa AA seqDB search
MSNGIFNREQLLQAATKPGKLWDVVVIGGGASGLGIALEAVTRGYQTLLVEQDDFAKGTS
SRSTKLVHGGVRYLAQGNIALVREASIERGLLQKNAPHLVKNQTFIIPVYSFWDRIKYTI
GLKLYDWIAGRLSLGPSVFISKKKTMEALPDIKQEGLVGGVQYHDGQFDDSRLALNLAQT
IIEQGGVALNYVKVTGLIKNERGQPSGIIAEDQETAAVYRIHAKAVVNATGVFVDDILKM
DNPSAPKSVVASQGVHLVLDKEFFSSPHALMIPETSDGRVLFAVPWHSEVVVGTTDTPVG
APSAEPRPLEKEIEFILNTSGQYLVKQPTRKDVLSVFAGLRPLAAPKEGTEKTKEISRSH
KIIISPTRLFTIIGGKWTTYRKMGQDMVDAVEKRMGWAATQTQTRHLQVHGFAKGMDWND
PFYFYGSDAEKIKAASNGHWLSEKLKLNKAQLQWAVQQEMARTVEDFLARRTRALFLDAK
ESIRIAGETATLMAEELHKDKAWADAETERFTTLAKQYIL
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacggaatatttaacagggagcagttattacaggccgcaacgaagccgggaaaa
ttatgggatgtagttgtgatcggtggtggtgcttcgggtttgggtattgccctggaggca
gtaacccgtggctaccagaccttgctggtagagcaggacgactttgcaaaaggaacctcc
agccgcagcaccaagctggtgcatggaggcgtgcgttacctggcccagggaaatattgct
ctggtgcgtgaagcgagcattgaacgggggcttttgcaaaagaatgcaccgcacctggta
aaaaaccagacctttattatccccgtttattcattctgggaccggatcaaatatactatt
ggtctgaagctttatgactggatcgcaggaaggctctctttaggcccttcggtgtttata
tccaaaaagaaaacgatggaagcgctgccggatataaagcaggaaggtctggtaggaggc
gtacaatatcatgacgggcagttcgatgattcaaggctggcattaaaccttgcacaaacg
atcattgagcagggtggtgtagcgctgaattatgtaaaggtgaccggtctgatcaaaaat
gaacggggacagccatccgggatcattgcagaagaccaggaaacggctgctgtttacagg
atacatgcaaaggcggttgtaaatgccacgggtgtttttgtagatgatattttgaaaatg
gacaatccttccgcacccaaaagcgtggtggccagccagggcgttcacctggtattggat
aaagagttcttttcttccccccacgcattaatgattcccgaaaccagtgatggccgtgta
ttgtttgccgtgccctggcatagtgaagtagtagtaggtaccacggataccccggttggc
gcaccttctgcagaacccaggcccctggagaaggaaatcgaatttatattaaacacctcc
ggccagtatcttgtaaagcaacccacccgcaaagatgtgctgagcgtatttgcagggctg
cggccgctggcagcacctaaagaaggaacagaaaaaacaaaagaaatttcgcgcagccat
aagatcattatttcccctacccgcctgtttactattattggtggcaaatggaccacttac
cggaaaatgggacaggacatggtggatgctgttgaaaagcggatgggatgggctgccacc
caaacacaaacccggcatttgcaggttcatggctttgctaaaggaatggactggaatgat
cccttttatttttatggaagtgatgcggaaaagataaaagccgcaagtaacgggcactgg
ctcagtgaaaagctaaaactgaacaaagcgcaattgcaatgggccgtgcaacaggaaatg
gcacgcactgtggaagatttcctggcgcgcagaacaagagcgttatttctggatgcaaag
gaaagcatacgcattgcaggggaaacggcaacgcttatggccgaagagctgcataaggac
aaagcctgggcagatgcggaaacagaacgatttacaacacttgcaaaacaatacatttta
taa

DBGET integrated database retrieval system