KEGG   Candidatus Nitrosopumilus piranensis: NPIRD3C_0557Help
Entry
NPIRD3C_0557      CDS       T03656                                 

Definition
(GenBank) Aminotransferase class I and II
  KO
K00812  aspartate aminotransferase [EC:2.6.1.1]
Organism
nid  Candidatus Nitrosopumilus piranensis
Pathway
nid00220  Arginine biosynthesis
nid00250  Alanine, aspartate and glutamate metabolism
nid00270  Cysteine and methionine metabolism
nid00330  Arginine and proline metabolism
nid00350  Tyrosine metabolism
nid00360  Phenylalanine metabolism
nid00400  Phenylalanine, tyrosine and tryptophan biosynthesis
nid00401  Novobiocin biosynthesis
nid01100  Metabolic pathways
nid01110  Biosynthesis of secondary metabolites
nid01130  Biosynthesis of antibiotics
nid01210  2-Oxocarboxylic acid metabolism
nid01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nid00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NPIRD3C_0557
   00270 Cysteine and methionine metabolism
    NPIRD3C_0557
   00220 Arginine biosynthesis
    NPIRD3C_0557
   00330 Arginine and proline metabolism
    NPIRD3C_0557
   00350 Tyrosine metabolism
    NPIRD3C_0557
   00360 Phenylalanine metabolism
    NPIRD3C_0557
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NPIRD3C_0557
  09110 Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    NPIRD3C_0557
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:nid01007]
    NPIRD3C_0557
Enzymes [BR:nid01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     NPIRD3C_0557
Amino acid related enzymes [BR:nid01007]
 Aminotransferase (transaminase)
  Class I
   NPIRD3C_0557
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AJM91771
UniProt: A0A0C5BU11
LinkDB All DBs
Position
467463..468785
Genome map
AA seq 440 aa AA seqDB search
MFQIQVEDHIDKVVMPDNLKVGLMVAEQREKCASGGCTGEFYGLGFGQSPFHVPPVLENA
LSENSDKGHYSAAEGILKLRQAIAGFNKRHFDLDVDPARIVIGPGTKDIINTLFGIIKGG
VILPSPSWIGYRPQIHLLNKHFHTFYLKPEHDYKINSKEFEEFVSKLSGKQHTLVLNNPH
NPTGALYTKDELEELANVCRRKNILVLADEIYALDSYDVSKFTSMAKVYPEGTFVTNGLS
KDRSAGGYRLGSCILPMTSCKKLASDYKKVAATVYTNVSTPIQYAAIKAYEQNDEIEDYI
STTRQIHQIMGEYLYQQWDALDGISTTKPEGAFYFFADFNSLSENLRKKGVNTSNQLAES
LLSCPFHIAVVTGDACMLKPDNFGARVAFVDYDGKKTFDDYKDKPPQNDSEKLEFVKRNA
PLMVRSVDSLKQWISYIKSD
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
ttgttccaaattcaagtagaagatcatattgacaaagtagtcatgcctgataatctaaaa
gttggattgatggttgcagaacaacgtgaaaaatgtgcttctggtggatgtactggagaa
ttctatggtcttgggtttggtcaatcacctttccatgttccacctgtcttggagaatgca
ctttcagaaaattctgacaaaggtcattattcagctgcagaaggaatattgaaattgcga
caagcaattgcaggatttaataaaagacattttgatttggacgttgatcctgcaagaatt
gttattggacctggaactaaagatatcataaatactctgtttggaataataaaaggagga
gttatcttgccttctccatcatggattggatacagaccacaaattcatcttttaaacaaa
cattttcacactttttatctaaaaccagaacatgattacaaaatcaattctaaagaattt
gaagagtttgtatctaaactttctggcaaacaacatacacttgtactgaataatcctcac
aaccctactggtgcattatacacaaaagatgagcttgaggaactggctaatgtttgtaga
cgaaaaaatattttggtattggcagatgaaatctatgcacttgattcctatgatgtatca
aaatttactagcatggccaaagtctatcctgaaggaacttttgttacaaatggcctctca
aaggatcgctcagcaggaggatataggcttggatcctgcattttacctatgacttcttgt
aaaaaactagcttcagactacaaaaaagtggcagcaacagtatacaccaatgtttcaaca
ccaattcagtatgcagcgataaaggcatatgagcaaaatgatgagattgaggactatatc
tcaactacaagacaaattcatcaaattatgggtgaatatttgtatcaacaatgggatgca
ctagatggaatctctacaacaaaacctgaaggtgctttttatttttttgctgactttaac
tctctttcagaaaatttgaggaaaaaaggtgttaatacgtcaaaccaacttgccgaatca
ttactgtcttgcccatttcacatagcagttgttactggtgatgcatgtatgttaaagcct
gacaattttggagcaagagttgcatttgttgattatgatggaaaaaaaacatttgatgat
tacaaagataaacccccacaaaatgattcagagaaattagagtttgtaaaaagaaatgca
cctctgatggtacgttcagttgattcgctcaaacaatggatctcttatatcaaaagtgat
taa

DBGET integrated database retrieval system