KEGG   Nitrosomonas sp. Is79A3: Nit79A3_0509Help
Entry
Nit79A3_0509      CDS       T01569                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K00666  fatty-acyl-CoA synthase [EC:6.2.1.-]
Organism
nii  Nitrosomonas sp. Is79A3
Brite
KEGG Orthology (KO) [BR:nii00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:nii01004]
    Nit79A3_0509
Enzymes [BR:nii01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.-  
     Nit79A3_0509
Lipid biosynthesis proteins [BR:nii01004]
 Acyl-CoA synthetase
  Unknown
   Nit79A3_0509
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C_2
Motif
Other DBs
NCBI-ProteinID: AEJ00389
UniProt: F8GIH0
LinkDB All DBs
Position
548555..550378
Genome map
AA seq 607 aa AA seqDB search
MSSTITKLNAPLTQAFDFQPSSELQLTPTPTLNTLTQQLAGFDTLTSALEYAAEGITGYN
FYDAKGNLRSVLPYSVLRQNARILAQRLFGFGLLRGSRVAIIADTSPEFVELFFACRYAG
LVPFAMPIPVNLGSHAIYVQQLRGMLESSQASIALANIDYINFLEEAAEETACIQWVGTP
GKLNEFPAMSVELQPNYPDETAYLQFTSGSTRTPRGVVITERALMCNLQGIVCNGLEIKP
DDRSASWLPFYHDMGLVGLVLAPMVTQISVDYLATRDFAIRPLQWLRLISRNRCTVAFSQ
PFGLKLCTLRVRESDLKDLDLSSWRAAGIGAEMIRPETLRNFAEKFASAGFDENAFLPCY
GLAESTLAVTFSKIGKGCKSIQVDSKTLIDKRMAARLQADGRKQNEFVNCGRPLPGHTVK
IIDEDGQQLSEMMVGSVLVQGDSVMMGYYNNPEETNKALKSGNWLDTGDIGFLFEGDLFI
TGRRTDVIIVNGRNIRAQDIEELAEQQPEVRSREASAFGVNDEDGTTTIVLVIECRLTSV
TERQSLTTRLQQLVYMAFGVNCVVELVPPHTLPRTSSGKLSRFAARQGYIQRTNLAGQLS
FVESGDR
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
ttgagttcgacaataaccaagttgaacgctccgctaacgcaagcgtttgattttcaacct
tcaagcgaattacaattaacaccgacaccgacactcaatacactaactcagcagttggcg
ggctttgataccctgactagcgctttagaatatgcagcggaggggataacggggtataac
ttttatgacgcgaagggcaacttacgttcggttctgccgtacagtgtactaagacagaat
gctcgtatcttagcgcaacgtttatttggttttggtttgctccgtggtagcagggtagca
atcattgctgatacctccccagagtttgtcgagttgttttttgcatgtcgctatgctggt
ttagtgccttttgcaatgccaattccggttaatctcggtagccatgcaatatacgttcag
caattaaggggtatgcttgagagcagtcaagcaagtattgcgctggcgaatattgactat
attaattttctggaagaggctgcggaagaaacagcctgtatacagtgggtaggaacacca
gggaagttaaacgagtttcctgcgatgagtgttgaactacagcctaattatcctgatgaa
actgcgtacctgcaatttacatcaggcagtacgcgtactcctagaggagtggttattact
gagcgagccttgatgtgcaatttacaaggtattgtatgtaatggtttggaaattaaacct
gacgatcgttctgcttcttggctgcccttttatcacgacatgggattggttgggttagtt
ctggcgccaatggttacgcaaatctctgttgattatttggcgacacgggattttgcaatc
cggcccttacaatggttacggttaataagccgcaaccgttgcactgttgcattcagtcaa
ccttttggtcttaagctctgtactttacgtgtaagggagtctgatctcaaagatctggat
ctcagcagttggcgagctgcaggtatcggtgccgagatgattcggccagaaactctgaga
aattttgctgaaaaatttgcatcggcaggttttgatgagaatgcttttttgccttgctat
ggccttgcggaatctacacttgccgttaccttttcaaaaattggtaaaggatgcaaaagt
atacaagttgatagtaaaacgcttatcgataagcgaatggccgccagattgcaagcggat
gggcgtaaacagaatgaatttgtaaattgtggacgtccgttacctggtcataccgtgaag
ataatcgatgaggatggtcaacaattgtcagaaatgatggttggcagtgttttagtacaa
ggcgatagcgtgatgatgggctattataacaatccagaagaaactaacaaagcacttaaa
tctggtaattggctggataccggagacattggatttctgtttgaaggtgatttgtttata
actggacgccgtacagatgtcattattgttaacggtcgcaatattcgtgcgcaagatata
gaagaattggctgaacagcaaccggaagtcaggtcgcgtgaggcttctgcgtttggagtg
aatgatgaagatggcacaacgactattgtattagtcattgaatgtagactcacttccgta
actgagcggcagtcactgacaacccggttgcagcagcttgtttatatggcattcggggtg
aattgtgttgttgaattggttccaccgcataccttgccacggacctcatctggaaagctt
tcacgttttgcagcgaggcaaggttatatacagagaacaaacctggcaggtcaactgtct
tttgtagaatcaggtgacagataa

DBGET integrated database retrieval system