KEGG   Nitrosomonas sp. Is79A3: Nit79A3_0813Help
Entry
Nit79A3_0813      CDS       T01569                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
nii  Nitrosomonas sp. Is79A3
Brite
KEGG Orthology (KO) [BR:nii00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:nii03012]
    Nit79A3_0813
   03029 Mitochondrial biogenesis [BR:nii03029]
    Nit79A3_0813
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nii04147]
    Nit79A3_0813
Translation factors [BR:nii03012]
 Eukaryotic Type
  Elongation factors
   Nit79A3_0813
 Prokaryotic Type
   Nit79A3_0813
Mitochondrial biogenesis [BR:nii03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Nit79A3_0813
Exosome [BR:nii04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Nit79A3_0813
  Exosomal proteins of breast cancer cells
   Nit79A3_0813
  Exosomal proteins of colorectal cancer cells
   Nit79A3_0813
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW AAA_23
Motif
Other DBs
NCBI-ProteinID: AEJ00688
UniProt: F8GKZ5
LinkDB All DBs
Position
891066..892256
Genome map
AA seq 396 aa AA seqDB search
MAKSKFERSKPHVNVGTIGHVDHGKTTLTAAITTILTKKFGGEAKSYAQIDSAPEERARG
ITINTAHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVGVPYIIVYMNKADMVDDAELIELVEMEIRELLSKYDFPGDDTPIIVGSALKALE
GDQSEIGEASILKLAEALDSYIPQPERAIDGAFLMPVEDVFSISGRGTVVTGRVERGVIK
VGEEIEIVGLKPTLKTVCTGVEMFRKLLDQGQAGDNVGILLRGTKREEVERGQVLAKPSS
ISPHTKFTAEIYVLSKEEGGRHTPFFPGYRPQFYFRTTDVTGAIELPAGTEMVMPGDNVS
VTVNLIAPIAMEDGLRFAIREGGRTVGAGVVAKIIE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaagtaaatttgagcggtcgaagccacacgtaaatgtaggtacgataggacat
gtcgatcatggaaagacgacgctgacggcggcgattacgacgatattgacaaagaaattt
ggtggtgaagcgaagagctacgcgcaaattgactcagcgccagaggaacgtgcgcgcgga
attacaatcaatacggcacatgtggagtatgagacagctaatcgccattatgcccacgta
gattgtcctgggcatgcggattatgtgaaaaacatgattactggtgcagcgcaaatggac
ggagcgatactggtggtgtcagcagcggatggcccgatgccgcaaacgcgtgagcatata
ctattagcacgccaagtaggcgtaccgtacatcatcgtatacatgaataaagccgacatg
gtggatgatgcggaattaattgagttagtggaaatggaaataagggaattgttgtcgaag
tacgactttcctggagatgacacgccaatcattgttggatccgctctaaaggcactggaa
ggcgatcaaagtgaaataggtgaagcctccatcctgaaactggcagaagcattagatagc
tatattccacaacccgaacgtgcaatcgatggtgcctttcttatgccggttgaagacgtt
ttctcgatctcaggtcgtggaacggtagtgactggacgagtggagagaggtgtcatcaaa
gtcggggaagaaatcgaaattgttggtcttaagcccacactgaagactgtatgtacaggt
gttgaaatgttccgtaaactgctggaccaaggtcaggcaggtgacaatgttggaatattg
ttacgtggtacgaaacgtgaagaagtagaacgaggtcaagttttggcaaagccaagtagc
atatcaccgcatactaaattcacggctgagatttatgtgttgagcaaagaagaaggtgga
aggcatacgccgtttttccccggatatcgtccgcaattttatttccgtacaacggacgtt
acaggggcaattgaattaccggcgggaactgagatggtaatgcctggggataatgtgtca
gtgacagtgaatttaatagcgccgatagcgatggaagatggattgcgttttgctatacgc
gaaggtggaagaactgttggtgccggtgtcgttgctaaaataattgaataa

DBGET integrated database retrieval system