KEGG   Nitrosomonas sp. Is79A3: Nit79A3_1255Help
Entry
Nit79A3_1255      CDS       T01569                                 

Definition
(GenBank) Ribulose bisphosphate carboxylase large chain
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
nii  Nitrosomonas sp. Is79A3
Pathway
nii00630  Glyoxylate and dicarboxylate metabolism
nii00710  Carbon fixation in photosynthetic organisms
nii01100  Metabolic pathways
nii01120  Microbial metabolism in diverse environments
nii01200  Carbon metabolism
Module
nii_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:nii00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Nit79A3_1255
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Nit79A3_1255
Enzymes [BR:nii01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Nit79A3_1255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: AEJ01097
UniProt: F8GEW5
LinkDB All DBs
Position
complement(1376270..1377691)
Genome map
AA seq 473 aa AA seqDB search
MAVKIYNAGVKEYRHTYWTPDYTPLDTDLLACFKITPQAGVPREEVAAAVAAESSTGTWT
TVWTDLLTDLDYYKGRAYKIEDVPGDDTCFYAFVAYPIDLFEEGSVVNVLTSLVGNVFGF
KALRALRLEDVRFPIAYVKTCGGPPAGIQVERDRLNKYGRALLGCTIKPKLGLSAKNYGR
AVYECLRGGLDLTKDDENVNSQPFMRWRDRFEFVVEACQKAERETGERKGHYLNVTAPTP
EEMYKRAEFAKELGAPIIMHDYLTGGLTANTGLANWCRNNGMLLHIHRAMHAVLDRNPHH
GIHFRVLTKVLRLSGGDHLHSGTVVGKLEGDRAATLGWIDTMRDKFIKEDRSRGLFFDQD
WGSMPGVFPVASGGIHVWHMPALVAIFGDDACLQFGGGTLGHPWGNAAGAAANRVALEAC
VEARNQGVEIEKEGKAILTKAAKSSPELKIAMETWKEIKFEFDTVDKLDVAHK
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atggcagtaaaaatatataacgctggtgtgaaagaatatagacacacttactggacccct
gattatactccgctggataccgatcttctggcatgtttcaaaattacgcctcaagccggc
gtacctcgtgaagaagttgctgctgcagtagctgcagaatcttcaacgggtacctggacc
acagtgtggactgatcttttaaccgatttggactactacaaaggacgtgcttataagatt
gaagacgttccaggcgatgacacttgtttctacgcattcgtagcttaccctatcgatctt
tttgaagaaggctccgtggttaacgtgctgacctcgctggtgggtaacgtgttcggtttt
aaagcgctacgcgcactgcgtctggaagatgttcgtttcccgattgcctacgtcaaaacc
tgcggcggacctccagcaggtattcaagtagaacgcgatcgtctgaacaaatatggccgc
gcgctgttaggttgtaccattaagcctaaactgggcctgtctgccaaaaactacggccgt
gctgtatacgaatgtctgcgcggcggtctggatctgactaaggacgatgagaacgttaat
agtcaaccttttatgcgttggcgtgatcgtttcgaattcgtggtggaagcttgccaaaag
gctgagcgtgaaactggagaacgtaaaggtcattacttaaacgtaaccgcaccaactcca
gaagaaatgtataaacgtgcagagtttgctaaagaattgggcgcaccgatcatcatgcat
gactacttgacgggtggtttaactgccaatacgggactggctaactggtgccgcaacaac
ggaatgctgttgcacattcaccgcgctatgcatgccgtactcgatcgcaacccgcaccat
ggcattcatttccgcgttttaaccaaggtactacgtttatccgggggtgatcacctgcat
tccggtaccgtggtaggcaaactagaaggtgaccgtgcagcaaccctcggctggatcgat
actatgcgtgacaaattcatcaaagaagaccgcagccgcggcctgttcttcgatcaagac
tggggttctatgccaggtgtattcccagttgcctcgggcggtattcacgtttggcatatg
ccagcactggttgctattttcggtgatgatgcctgcttgcaattcggtggcggtacctta
ggtcacccatggggcaatgctgctggtgccgctgctaaccgcgtggcattggaagcctgc
gtcgaagcacgtaaccaaggtgttgaaatcgagaaggaaggcaaagcgattctaaccaaa
gctgctaagagcagtcccgaactgaaaattgccatggaaacatggaaagaaattaagttc
gagtttgatacggttgataagctcgacgtagcccacaagtaa

DBGET integrated database retrieval system