KEGG   Nitrosomonas sp. Is79A3: Nit79A3_1690Help
Entry
Nit79A3_1690      CDS       T01569                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase/D-alanyl-D-alanine-endopeptidase
  KO
K07259  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase (penicillin-binding protein 4) [EC:3.4.16.4 3.4.21.-]
Organism
nii  Nitrosomonas sp. Is79A3
Pathway
nii00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:nii00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Nit79A3_1690
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:nii01002]
    Nit79A3_1690
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:nii01011]
    Nit79A3_1690
Enzymes [BR:nii01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Nit79A3_1690
   3.4.21  Serine endopeptidases
    3.4.21.-  
     Nit79A3_1690
Peptidases [BR:nii01002]
 Serine Peptidases
  Family S13: D-Ala-D-Ala peptidase C family
   Nit79A3_1690
Peptidoglycan biosynthesis and degradation proteins [BR:nii01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   Nit79A3_1690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S13 Beta-lactamase2
Motif
Other DBs
NCBI-ProteinID: AEJ01505
UniProt: F8GIK3
LinkDB All DBs
Position
1806705..1808147
Genome map
AA seq 480 aa AA seqDB search
MIRICLYLSLLILLSALSVSVFSNELPLTVKQKLLQAAIPESAIGVYVQEIGANQPIVAA
NADVAMNPASVMKLLTTYAGLELLGPAYTWPTILYANGKVTDGVLDGDLIIKGYGDPKLD
LENFWLLIHRLRQTGLHEIQGNLVLDHSHYDIPNDDPGEFDGQPYRTYNILPEALLVNYR
TSTIHLFPQPEKNSVRVAVDPLPESLQVQNNLKLTQGACGDWRNSLSIDAIADKEDKNNF
TVVLNGSFSKQCGKQSYMLSLQDSAIYTRDLFKRLWAQQGGLFHGDVIVSGTPKGLSPLK
IYQSPPLADVIRGINKFSNNIAARQLYLTLGTGEVVSNNSPATLAKSDAAIRQWLATKRL
NFPELVVENGSGLSRKERISARHMGQLLLAAFKSPVMPEFISSLPIAAVDGTLKNRFTDT
PVKGLAHMKTGALNDVRALAGYLLDKMGRRVIVVFFVNHDQAGQSRVAMDMLVQWVYNRQ
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgatccgtatttgcctgtatctcagtctgttgatcctgctaagcgcactatcggtttct
gtattttccaatgaactgccccttaccgttaaacaaaaactgctacaagccgccattccg
gaatccgctatcggtgtgtatgtacaggagattggtgcgaatcagccgattgtggcggct
aatgccgatgtggcaatgaatcctgcttcggtgatgaagttattgacaacatatgccgga
ctggaattactcgggcctgcgtatacttggccgactatactgtatgccaatggcaaagtc
acagatggtgttttggatggcgacctgatcattaaggggtatggtgatcccaaactggat
ttggagaatttctggctgttgattcatcgtttgcgtcaaaccggattgcatgaaattcaa
ggtaatctggttttggatcattcgcattatgatattcccaatgatgatcccggtgagttt
gacgggcagccttatcgcacctacaacattcttccggaagcattgttggtgaattaccgc
acatccacgatacatctgtttccgcaaccggaaaagaattcagtgcgtgtcgctgttgat
ccattgccggaatctttgcaggtgcagaataacttgaagcttacccagggtgcctgtgga
gattggcgcaactcactgtcgattgatgcgattgcggataaagaagataaaaataatttt
accgtggttctgaacggtagtttttccaagcagtgcggcaaacaatcgtatatgttgagt
ctgcaagacagcgccatctatacgcgggatttgtttaaacgcctatgggcacagcagggc
ggtctgtttcatggcgatgtgatcgtgagtgggacaccaaagggtttgtcaccgcttaag
atttatcagtccccgccactggcggatgtcattcggggcattaacaaattcagcaataat
attgcagcgcggcaactctatttgacactaggcacgggtgaggtggtaagcaataattct
ccggctactttggcaaaatcggatgcggctatccggcaatggctggcaaccaagcgcttg
aatttcccggaattggtggtggagaatggctccgggttgtcacgcaaggaacggatcagc
gcccggcatatgggacagcttttgcttgcggcttttaaaagtccggtaatgccggagttt
atttcgtcacttcccattgcggcagtggatggaactttgaaaaatcgttttacggataca
ccggtgaaaggtttggcgcatatgaaaacaggtgcgttaaacgatgtgcgcgcactggcg
ggatatttgctggacaaaatggggcggcgtgtcattgtggtcttctttgtcaatcacgat
caagccggacaatcccgtgttgcgatggatatgctggtgcaatgggtttataaccggcaa
taa

DBGET integrated database retrieval system