KEGG   Nitrosomonas sp. Is79A3: Nit79A3_2709Help
Entry
Nit79A3_2709      CDS       T01569                                 

Definition
(GenBank) peptidase S11 D-alanyl-D-alanine carboxypeptidase 1
  KO
K01286  D-alanyl-D-alanine carboxypeptidase [EC:3.4.16.4]
Organism
nii  Nitrosomonas sp. Is79A3
Brite
KEGG Orthology (KO) [BR:nii00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Nit79A3_2709
Enzymes [BR:nii01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Nit79A3_2709
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 Beta-lactamase2 SPOR DUF1381
Motif
Other DBs
NCBI-ProteinID: AEJ02465
UniProt: F8GGY3
LinkDB All DBs
Position
complement(2877627..2878862)
Genome map
AA seq 411 aa AA seqDB search
MFTLKHAIRKGLLVLAVLLSLSLANQAQANPRYSSIVIDADTGVVLHESNADASRYPASL
TKMMTLYMLFEAIEQRKMSLDERMQVSAHAASMPQTNIGLRAGDSISVRDAIPALIVRSA
NDVAAVVAEALGSSEANFGHMMTDKARKLGMHSTTFRNASGLPNGEQKTTARDLVTLSTR
LMRDFSKHYHYFSTQTFSYNGATYRSHNRMVRNTPGVDGLKTGFIRASGFNVATSAKRGG
RRVIAVVMGGQTAAARDQHMAQLLDRSFNQGHTTQQLASNTSNTRAVPVAALKTSTSTPV
PKPSPVLEKISVSVVTQPVVQPAVNARPQKVAMLENDTWAVQIGSYHEPDRAHAQAQAAA
RWVPGEVMVTEVEISNRKLYRARLVGLHESQARTACQNLARQGMGCLVVRS
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgtttactttgaaacatgcaataagaaaaggactgcttgttcttgctgtcttgttgtca
ttgtccctagccaatcaagcgcaggcaaatccccgctattcctctatcgtaatagatgcg
gatacaggtgtagtactgcacgaatctaacgctgatgccagccgttatccagcatctcta
accaagatgatgaccctctatatgctgttcgaggcgattgaacaacgcaagatgtcgttg
gatgagcgaatgcaagtgtcggcgcatgcggcatcaatgccgcagacgaatatcggctta
cgtgcaggagatagtatcagtgtgcgtgatgcgattccggcattaattgtacgttctgcc
aacgatgtggcagcagtggtagccgaggcgcttggcagtagcgaagcaaactttggccat
atgatgactgataaggcacgtaaactgggtatgcattccaccactttccgtaatgcttct
ggtttacccaatggtgagcaaaagaccacagcccgggacttggtgactttgtcgacacga
ttaatgagggatttttccaagcactaccattatttctctacccagacattcagctacaat
ggtgctacttatagaagccataaccgcatggtgcgaaataccccaggtgtggatggcttg
aaaaccggatttattcgcgcctctgggttcaatgtagctacttccgccaaacgtggtggc
cgtcgtgtaattgcagtagtaatgggcggacaaaccgcagctgcgcgtgatcagcatatg
gcacaattgctcgatcgcagttttaaccagggacacacgactcagcagttggccagcaat
actagtaatacccgcgctgtgccggttgcagccttgaagactagtacttcgactcctgta
ccgaaaccatctcccgtgctggaaaagatatctgtttccgtcgtgacgcaaccggttgta
caaccggcggtcaatgcacggccgcaaaaagttgcgatgctggagaatgacacttgggcc
gtgcagataggttcttatcatgaacccgaccgggctcatgcccaggcccaagccgctgct
cgttgggtaccaggagaagtgatggtcactgaggtggaaatcagtaaccgcaagttgtat
cgggcgaggctggtgggtttgcacgaaagccaagcacgcacagcctgccagaatctcgcc
cggcaagggatgggatgcttggtggtacgatcatag

DBGET integrated database retrieval system