KEGG   Nitrosomonas sp. Is79A3: Nit79A3_3236Help
Entry
Nit79A3_3236      CDS       T01569                                 

Definition
(GenBank) ribulose bisphosphate carboxylase small chain
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
nii  Nitrosomonas sp. Is79A3
Pathway
nii00630  Glyoxylate and dicarboxylate metabolism
nii00710  Carbon fixation in photosynthetic organisms
nii01100  Metabolic pathways
nii01120  Microbial metabolism in diverse environments
nii01200  Carbon metabolism
Module
nii_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:nii00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Nit79A3_3236
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Nit79A3_3236
Enzymes [BR:nii01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Nit79A3_3236
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: AEJ02970
UniProt: F8GL96
LinkDB All DBs
Position
3433448..3433882
Genome map
AA seq 144 aa AA seqDB search
MMTNPGNIVTQGQFSFLPPLTDKQISTQLKYALKNGWAIGIEYTDDPHPRNTYWEMFGNP
MFDLKDPAGILMEINSCRKTFPNHYIRVTAFNSTRGVESPTMSYIVNRPEKEPGFGLVRQ
EGAGRSISYTIHSYATDKPEAERY
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgatgaccaatccaggtaacatcgtcacacaggggcaattttctttcctacccccgttg
accgacaagcaaatttcaacacagctcaagtatgcgttgaaaaatggctgggcaatcgga
attgaatatacagatgatcctcacccacgtaacacgtactgggaaatgtttggcaatcct
atgtttgatttgaaagatccggcaggaattttgatggaaattaatagctgccgcaaaact
ttcccaaatcactatatccgtgtgactgcgtttaactcaacacgcggcgtggaaagtccg
accatgtcatatattgtcaaccggcctgagaaagaaccaggttttggtttagtacgtcaa
gaaggtgcggggcggagtattagttataccattcactcctatgcaaccgacaaaccggaa
gctgagcgctactag

DBGET integrated database retrieval system