KEGG   Nitrincola sp. KXZD1103: F5I99_15910Help
Entry
F5I99_15910       CDS       T06212                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
nik  Nitrincola sp. KXZD1103
Brite
KEGG Orthology (KO) [BR:nik00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    F5I99_15910 (ahpF)
Enzymes [BR:nik01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     F5I99_15910 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_binding_2 Thioredoxin_3 HI0933_like DAO FAD_oxidored FAD_binding_3 AlaDh_PNT_C Thi4 K_oxygenase Glutaredoxin FMO-like NAD_binding_8 Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: QEW07856
UniProt: A0A5J6LHU1
LinkDB All DBs
Position
complement(3449611..3451179)
Genome map
AA seq 522 aa AA seqDB search
MLDANLKKQLDTYLQNIVNPIEITVSTDESAKSKELLGLCQEIAELSDKISLKQLTDGSE
RTPSMAIAPVGETPRVRFAGIPMGHEFTSLVLALLQSGGYPSKAEAALIEQAKSLQGEFH
FETYISLSCQNCPDVVQALNLMAVLNPNVTSVMIDGALFQDEVTEREIMAVPTVLLNGKP
FGQGRMTLKEILGKVDAGASKREAADLNKKEPYDVLIVGGGPAGAAAAIYAARKGIRTGL
VAERFGGQVMDTVGIENFISVNYTEGPKLVASLEQHVKEYDVEVMDNQRASKLRREKLIE
IDLENGATLKSKSVILATGARWREMNVPGEQEYRGKGVAYCPHCDGPLFKGKRVAVIGGG
NSGIEAAIDLAGIVEHVTVLEFGDTLRADAVLQKKAASMANITIIKMAQTTQVRGDGKKV
IGLTYKDRNDNQTYDLDVAGIFVQIGLVPNTDWLKDTLELSRFGEIEVNSHGETHIPGVF
AAGDVTNVPYKQIIIAMGNGSAAALGAFDYLIRSSVEDEAAA
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgttggatgcgaatcttaagaaacaactggacacttatctgcagaatatcgttaatccg
attgagattactgtgtccactgacgaaagtgcaaaatcgaaagagctgcttggcttgtgt
caggaaatagctgagctgagtgacaaaatcagccttaagcaactgaccgatggcagtgaa
agaaccccgagcatggcaattgcgccggtcggtgaaactccacgggtacgttttgccggt
attccgatggggcacgaatttacctcgctggtactggctctgttacagagcggtggttat
ccttccaaagctgaagcggcgttgattgagcaggccaaaagcctgcaaggtgagtttcat
tttgaaacctatatttcgctctcctgccagaactgcccggatgtggttcaggcactgaac
ctgatggcagtacttaatccaaatgtcaccagtgtgatgatcgatggcgccttgtttcag
gatgaagtgaccgagcgggaaattatggccgtgccaacggttttgctgaatggcaagccc
tttggtcagggacgtatgacgctgaaagaaatactgggtaaggtcgatgccggtgcttcc
aagcgtgaagctgccgacctgaataaaaaagagccttatgatgtgctcatcgtcggtggt
gggcccgccggtgctgcggctgccatctatgctgcacgtaaaggtatacgcacaggtctg
gttgccgagcgtttcggtggacaggttatggacacggtgggtattgagaactttatctcg
gtgaactacaccgaaggccccaaactggttgccagcctggaacagcatgttaaagagtat
gacgttgaggttatggataatcaacgtgcgagcaagttgcgtcgtgaaaagctgattgaa
atcgatctggaaaatggcgcaacgctgaagagcaagtccgtcatcctggcaaccggtgcg
cgctggcgcgaaatgaacgtaccgggtgagcaggaataccgtggtaagggtgtcgcctac
tgcccgcactgtgatggtccgctgtttaaaggcaagcgtgtcgcggtgattggtggcgga
aattccggtattgaagcggccatcgaccttgctggtattgttgagcatgtgaccgtgctg
gagtttggtgacacgctgcgtgctgatgccgtgctgcaaaagaaagcggcttccatggcc
aatatcaccatcattaaaatggcacaaaccacacaagtgcgtggtgatggcaaaaaagtg
atcggtctgacctataaagaccgtaacgataaccagacctatgatctggatgtggcgggt
atctttgtgcaaatcggactggtaccgaataccgattggctgaaagacactctggaactg
tcacgttttggtgaaatcgaagttaatagccacggcgaaacgcatattccgggagtgttt
gccgccggtgatgtcacaaacgtgccttataaacagattatcattgccatgggcaatggc
tctgcagcggcgttaggtgcttttgattatctgatccgctcatcagtggaagacgaagcc
gctgcctga

DBGET integrated database retrieval system