KEGG   Candidatus Nitrosopumilus sediminis: NSED_06105Help
Entry
NSED_06105        CDS       T02303                                 

Definition
(GenBank) ATP-dependent DNA ligase I
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
nir  Candidatus Nitrosopumilus sediminis
Pathway
nir03030  DNA replication
nir03410  Base excision repair
nir03420  Nucleotide excision repair
nir03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:nir00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    NSED_06105
   03410 Base excision repair
    NSED_06105
   03420 Nucleotide excision repair
    NSED_06105
   03430 Mismatch repair
    NSED_06105
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:nir03032]
    NSED_06105
   03400 DNA repair and recombination proteins [BR:nir03400]
    NSED_06105
Enzymes [BR:nir01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     NSED_06105
    6.5.1.6  DNA ligase (ATP or NAD+)
     NSED_06105
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     NSED_06105
DNA replication proteins [BR:nir03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    NSED_06105
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     NSED_06105
DNA repair and recombination proteins [BR:nir03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     NSED_06105
   NER (nucleotide excision repair)
    Other NER factors
     NSED_06105
   MMR (mismatch exicision repair)
    Other MMR factors
     NSED_06105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase mRNA_cap_enzyme
Motif
Other DBs
NCBI-ProteinID: AFS83023
UniProt: K0B9Y6
LinkDB All DBs
Position
1011757..1013523
Genome map
AA seq 588 aa AA seqDB search
MEYSILAESLNKMESTTKRLELTQHLVELFEKTPHDVISKIVYLIQGKLRPDFEGIELGV
AEKLAIRAISKSSGIPIKKIEDEYRKGGDLGHASTVILEQKTQTTFLVEDITVERVYDTL
FKIAKLGGTRSQDMKMKYISSLLNDATPLEASYILKILLGTLRLGIAENTVMDALAIAFS
GNKENRKKLQYAYNVSSDLGKVAETIATKGLEGIEEFEIILFNPIRPMLADRVKSEEEAI
EKMGNEFAAEYKLDGERVQLHIEGDKVELFSRSLERIESYYPDIIEKIPKNIQADNIILE
AEAVAINENTGEFLPFQELMHRRRKYKIEKAVTEYPITVNFFDILYCNGKSCIDLSYKER
REKLEKHVKEDEFAKYIPMKIVKNQSEIEDFMENSINAGSEGLMLKMLDKPYQAGSRGSH
WLKLKREYRNELGDSLDLVVIGGFFGKGRRTGNYGTLLLATYDEDEDTFPSICKVGTGFS
DESLDQLYQILHPKVSIKKNPRIISDMEADVWFEPELVIEVVASEITLSPIHKAAFNEIR
KDAGLALRFPKFTGKIRVEKAAEDASTNEEVITLYKGQKKVAHDKNLM
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atggaatattcaatattagctgaatcattaaacaaaatggaatcaactacgaaaagatta
gagttaacacagcatttagtagaattatttgaaaaaacacctcatgatgttatttccaaa
atagtgtatttgattcaaggcaaattaagaccagactttgaaggaatagaattaggtgtt
gctgaaaaacttgcaataagggcaatttcaaaatcatcagggattccaataaaaaaaatt
gaagatgaatatagaaaaggtggagacctaggtcatgcatcgacggtgattttagaacaa
aaaactcaaactacatttcttgtagaagacatcacagttgaaagagtgtatgacacgtta
ttcaaaattgcaaaactaggaggaactagatcacaggatatgaaaatgaaatacatttca
agtctgctaaacgatgcaactccacttgaagcaagctacattttgaaaattttgttagga
actctgagattaggaattgctgaaaatacagtaatggatgcactagcaatagcattttca
ggcaataaggaaaatagaaaaaaattacaatacgcatacaacgtttccagcgatttaggc
aaagttgctgaaacaattgcaacaaaaggactagaaggcatagaagaatttgaaataatt
ttgtttaatcccatcagacccatgctagctgacagagtaaaaagcgaagaagaagcaata
gaaaaaatgggaaatgagtttgcagcagaatacaagctagatggagaaagagttcaactt
cacattgaaggagataaagttgaattgttttctagaagtttagaaagaatcgaaagctat
tatccagacataatagagaaaattcctaaaaacattcaagcagataatattattttagag
gctgaagcagttgcaatcaacgagaacacaggagagtttttaccatttcaagaattaatg
cacagaagaagaaaatacaaaatagaaaaagcagtgacagagtatccaattacggtaaac
ttttttgacattttgtactgcaatggaaaaagttgtatagatctaagttacaaagaaaga
agagaaaaacttgaaaaacacgtcaaggaagatgaatttgcaaaatacattcccatgaaa
atagtgaaaaatcaaagcgagattgaagactttatggaaaacagcatcaatgcagggagc
gaagggctaatgctaaaaatgctagacaaaccatatcaggcaggatctagaggaagtcat
tggttaaaactaaaacgagaatacagaaacgagttaggagatagtttagatcttgttgta
ataggaggattttttggtaaaggtagaagaactggaaattatgggacactgctcttagca
acttatgatgaagatgaagatacattccccagtatttgtaaagtgggaacaggtttttca
gatgaatctttagaccaattataccaaatacttcatccaaaagtatcaattaaaaaaaat
ccacgcatcataagtgatatggaggcagacgtatggtttgaaccagagttagttattgaa
gtagttgcatcagaaataacccttagcccaattcataaagcagcatttaatgaaattcga
aaagatgcaggtttagccttgagatttccaaaatttacaggaaagatcagagttgagaaa
gcagcagaagatgcgtccacaaatgaagaagtaatcacactatacaaaggacagaaaaaa
gtagcacatgacaaaaatttgatgtaa

DBGET integrated database retrieval system