KEGG   Candidatus Nitrosopumilus sediminis: NSED_07185Help
Entry
NSED_07185        CDS       T02303                                 

Definition
(GenBank) lysine biosynthesis protein LysX
  KO
K05827  [lysine-biosynthesis-protein LysW]---L-2-aminoadipate ligase [EC:6.3.2.43]
Organism
nir  Candidatus Nitrosopumilus sediminis
Pathway
nir00300  Lysine biosynthesis
nir01100  Metabolic pathways
nir01210  2-Oxocarboxylic acid metabolism
nir01230  Biosynthesis of amino acids
Module
nir_M00031  Lysine biosynthesis, mediated by LysW, 2-aminoadipate => lysine
Brite
KEGG Orthology (KO) [BR:nir00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    NSED_07185
Enzymes [BR:nir01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.43  [lysine-biosynthesis-protein LysW]---L-2-aminoadipate ligase
     NSED_07185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RimK ATP-grasp_3 GSH-S_ATP ATPgrasp_ST CPSase_L_D2 ATP-grasp ATP-grasp_5 ATP-grasp_2 Rimk_N
Motif
Other DBs
NCBI-ProteinID: AFS83231
UniProt: K0BFX8
LinkDB All DBs
Position
1204884..1205726
Genome map
AA seq 280 aa AA seqDB search
MNPDVTILYDTIRWEEKALLEAGKKKNINIQMVDCKKLAIDLEKKPEDYGIVIQRCVSYY
RNLHSTAALEGIGVKVINCLNTGVFAGNKLFTHMLLKKFGVPTPDATVAFSKEAALQALD
SQGYPKVIKPTVGSWGRLISKLNDRDAAEGIIESRENMYPIYQVHYLEEFVKRPPRDIRA
IMIGDKIVAAIYRTSKHWKTNMALGGTAEPCKVTQEMEEMCIKAKHAIQGDIVGVDLMES
DEKGLVVHEVNNTTEYKNTVRVCEVDIPSLMLDYALKMEK
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
gtgaatcctgacgttaccattctttacgataccatccgttgggaagaaaaagctctgcta
gaagccggtaaaaaaaagaacattaacatccagatggtcgattgtaagaaattggcaata
gatttagaaaaaaaacctgaagattatggcattgttattcaaagatgtgtaagttactat
agaaatcttcattcaactgcagctcttgaaggaattggtgtgaaggtaatcaattgtcta
aacacaggggtatttgcaggaaataaattattcacacatatgttactaaagaaatttgga
gtgccgacacctgatgcaactgttgctttttcaaaagaagcagctttacaagcattagat
tcacaaggatacccaaaagtgatcaaaccaacagttggtagttggggcagattaatttca
aaattaaatgacagagatgcagctgaggggatcattgaaagcagagagaacatgtatcca
atctatcaagttcattatttggaagaatttgtaaaaagacctccaagagatattagagca
ataatgataggagacaaaattgtagcagcaatttatcgtacttctaaacattggaaaacc
aacatggcattaggaggcacagcagagccatgtaaagtaacgcaagaaatggaagaaatg
tgcattaaagcaaaacatgcaattcaaggagatattgtaggtgtcgatttgatggaaagt
gatgagaaaggattggtcgtacatgaagtaaacaacactacagaatacaagaacacagta
agagtgtgtgaagttgacattccttccttaatgttagattatgcactgaagatggaaaag
tag

DBGET integrated database retrieval system