KEGG   Nitratiruptor sp. SB155-2: NIS_0260Help
Entry
NIS_0260          CDS       T00565                                 

Gene name
tufA
Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
nis  Nitratiruptor sp. SB155-2
Brite
KEGG Orthology (KO) [BR:nis00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:nis03012]
    NIS_0260 (tufA)
   03029 Mitochondrial biogenesis [BR:nis03029]
    NIS_0260 (tufA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nis04147]
    NIS_0260 (tufA)
Translation factors [BR:nis03012]
 Eukaryotic Type
  Elongation factors
   NIS_0260 (tufA)
 Prokaryotic Type
   NIS_0260 (tufA)
Mitochondrial biogenesis [BR:nis03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    NIS_0260 (tufA)
Exosome [BR:nis04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   NIS_0260 (tufA)
  Exosomal proteins of breast cancer cells
   NIS_0260 (tufA)
  Exosomal proteins of colorectal cancer cells
   NIS_0260 (tufA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 Ribosomal_S8 RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: BAF69374
UniProt: A6Q1L5
LinkDB All DBs
Position
248459..249658
Genome map
AA seq 399 aa AA seqDB search
MAKEKFVKTKPHVNIGTIGHVDHGKTTLTAAITAVLAEKGYAEKRDYDQIDNAPEERERG
ITIATSHVEYETDKRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVGVPYIVVFLNKEDMVDDPELLELVEMEVRELLNEYDFPGDDVPVIAGSALKALE
EAKEGKLGEWSEKILKLMEAVDEYIPTPERDIDKPFLMPIEDVFSISGRGTVVTGRIERG
VVKVGDEIEIVGLRPTQKTTVTGVEMFRKELDQGEAGDNVGVLLRGTKKEEVERGQVLAQ
PGTITPHTKFEAEIYVLTKEEGGRHTPFFSGYRPQFYVRTTDVTGTITLPEGVEMVMPGD
NVKINAELIAPIALEEGTRFAIREGGRTVGAGVVSKIIE
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagaaaagtttgtcaaaaccaagccgcatgtgaacatcggtactatcggtcac
gttgaccacggtaaaacaactcttactgctgcaatcactgcagtacttgcagaaaaaggg
tatgcagaaaaaagagattatgatcaaatcgataatgcacctgaagagagagaaagaggg
attactatcgctacttctcacgtagagtatgaaactgacaagagacactacgcacacgtt
gactgtccagggcacgccgactacgttaaaaacatgattaccggtgctgctcagatggac
ggagcgattcttgttgtttctgccgcagacggtcctatgcctcaaacaagagagcacatc
cttcttgcacgacaggttggtgttccttatatcgttgtttttctaaacaaagaagatatg
gttgatgatccagaacttcttgaacttgttgaaatggaagttcgagaacttttgaatgaa
tacgattttccaggagatgatgttcctgtaattgctggttctgcactaaaagctttggaa
gaagctaaagagggcaaactcggtgaatggagcgaaaaaattcttaagcttatggaagcg
gttgatgaatatattccaactcctgaaagagacatcgataagccattcttgatgccaatt
gaagacgtattctctatctctggtcgaggtactgttgttactggtagaatcgaaagaggt
gttgtaaaagttggagatgaaattgaaatcgtaggacttcgaccaactcaaaaaacgact
gttactggcgttgaaatgtttagaaaagagctagatcaaggtgaagctggtgacaacgtt
ggtgtacttcttcgaggtactaaaaaagaagaggttgaaagaggtcaagttcttgctcaa
ccaggaactatcactcctcatacaaaatttgaagcagaaatttacgtattgacaaaagag
gaaggtggacgacacactcctttctttagcggatatcgaccacagttctatgtacgaacg
actgacgttactggaactattacacttccagaaggcgttgagatggttatgcctggagat
aacgttaaaatcaatgcagaacttatcgcacctatcgctcttgaagagggaacacgattc
gctatccgagagggtggtagaactgttggtgctggtgtagtaagtaaaatcatcgaataa

DBGET integrated database retrieval system