KEGG   Nitrosomonas sp. AL212: NAL212_0275Help
Entry
NAL212_0275       CDS       T01443                                 

Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase, B subunit
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
nit  Nitrosomonas sp. AL212
Pathway
nit00970  Aminoacyl-tRNA biosynthesis
nit01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nit00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    NAL212_0275
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:nit03029]
    NAL212_0275
Enzymes [BR:nit01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     NAL212_0275
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     NAL212_0275
Mitochondrial biogenesis [BR:nit03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    NAL212_0275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: ADZ25231
UniProt: F9ZJJ3
LinkDB All DBs
Position
134408..135847
Genome map
AA seq 479 aa AA seqDB search
MHWEIVIGLEVHAQLSTQSKIFSGASTAYGAPPNTQACVIDLALPGVLPVLNKGAVERAI
RFGLSVGAKINSPSIFARKNYFYPDLPKGYQISQYELPVVQGGNIRIPADGVEKNIRLTR
AHLEEDAGKSLHEDFHGMSGIDLNRAGTPLLEIVSEPDMRSSAEAVTYAKTLHALVRWIG
ICDGNMQEGSFRCDANVSVRPRGIEKLGTRCEIKNLNSFRFLEKAIDYEARRQIEILEDG
GAIRQETRLYDANKDETRTMRTKEDANDYRYFPDPDLLPLEIPASWIDQVRSALPELPQV
RRDRYMSEFALSAYDASVLTSSRETADYFESTIRQLPAQEKLCANWIMGEISGQLNKEGL
EISACPITPSQLAMLLERISDGTISGKAAKTVFESMWNGELEKNVDAIIAVKGLKQISDD
SAIEKLVDQVLAANAQQVADYRNGKEKAFNSLVGQIMKATHGKANPAQVNVILKKKLEG
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgcattgggaaattgtcatcggcctggaagtacatgctcaactttcaacgcaatctaaa
atcttctcaggcgcatctaccgcctatggcgccccgccgaatacgcaggcgtgtgttatt
gacttggcattgcccggcgttttgccggtactcaacaagggcgcggttgagcgggcaatc
agattcggcttgtcggtaggtgccaaaattaactcgccatctatttttgcgcgcaaaaat
tatttttatcctgatttgccgaaaggctatcaaatcagtcaatacgaattaccggtggtg
caaggtggcaacattcggattccggccgatggcgtagaaaaaaacattcgtttgactcga
gcacatctggaggaggacgccggaaagtcgctgcacgaggattttcatggtatgagtggg
attgatctgaatcgggctggcacgcccttgctggaaattgtttctgagccggatatgcgc
agcagtgcggaagccgtgacttatgcgaaaacacttcatgccctggtgcggtggatcggt
atttgcgatggcaatatgcaggaaggctctttccgttgcgatgccaatgtttcggtacgt
ccccgaggtatagaaaaacttggtacacgctgcgaaatcaagaatttgaattcatttcgt
tttcttgagaaagcgatcgattatgaagccagaagacaaattgaaatcttggaagacggc
ggcgccattcggcaggaaactcgtttgtacgatgctaacaaagatgaaacacgaactatg
cgtaccaaggaagatgccaacgattaccggtattttcccgatccggatttattgccgctc
gaaattcctgcaagctggattgatcaggtgcgatcagccttaccggaattgccgcaagtg
cgacgggatcgttatatgtccgagtttgcgctatctgcttatgatgcctccgtcttaacc
agttcgcgcgaaactgcagattattttgaatcaacgatcaggcaattgcctgcgcaagaa
aaattgtgtgccaactggatcatgggcgagatcagcggacaattgaacaaagaagggctt
gaaatcagcgcatgcccaatcaccccttcccaactcgctatgctgctggagcgcatcagt
gatggcaccatttccggtaaggcagccaaaacggtatttgaaagcatgtggaatggtgag
ctggaaaagaatgtcgatgccattattgccgtaaaaggactaaaacaaatttccgacgat
agcgctattgagaaactggtcgatcaagtactggctgctaatgcgcagcaagttgcagac
tatcggaatggcaaagaaaaagccttcaactcactggtcggtcagatcatgaaagcaacg
catggaaaagccaacccagcacaggtgaatgttattctgaaaaagaaactggagggataa

DBGET integrated database retrieval system