KEGG   Nitrosomonas sp. AL212: NAL212_0872Help
Entry
NAL212_0872       CDS       T01443                                 

Definition
(GenBank) Ribulose-bisphosphate carboxylase
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
nit  Nitrosomonas sp. AL212
Pathway
nit00630  Glyoxylate and dicarboxylate metabolism
nit00710  Carbon fixation in photosynthetic organisms
nit01100  Metabolic pathways
nit01120  Microbial metabolism in diverse environments
nit01200  Carbon metabolism
Module
nit_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:nit00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    NAL212_0872
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    NAL212_0872
Enzymes [BR:nit01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     NAL212_0872
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: ADZ25799
UniProt: F9ZF99
LinkDB All DBs
Position
complement(765280..766701)
Genome map
AA seq 473 aa AA seqDB search
MAVKIYNAGVKEYRQTYWTPDYTPLDTDILACFKITPQPGVPREEVAAAVAAESSTGTWT
TVWTDLLTDLDYYKGRAYKIEDVPGDDTCFYAFVAYPIDLFEEGSVVNVLTSLVGNVFGF
KALRALRLEDVRFPIAYVKTCGGPPAGIQVERDRFNKYGRALLGCTIKPKLGLSAKNYGR
AVYECLRGGLDLTKDDENINSQPFMRWRDRFQFVVEACQKAERETGERKGHYLNVTAPTP
EEMYKRAEFAKELGAPIIMHDYLTGGLTANTGLANWCRNNGMLLHIHRAMHAVLDRNPHH
GIHFRVLTKVLRLSGGDHLHSGTVVGKLEGDRAATLGWIDTMRDKFIKEDRSRGLFFDQD
WGSMPGVFPVASGGIHVWHMPALVAIFGDDACLQFGGGTLGHPWGNAAGAAANRVALEAC
VEARNQGVEIEKEGKAILTKAAKSSPELKIAMETWKEIKFEFDTVDKLDIAHK
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atggcagtaaaaatatataacgctggtgtaaaagagtatagacaaacttactggactcct
gattacaccccattggatactgatattctggcatgttttaaaatcacaccacaacccggc
gtgcctcgcgaagaagtagcggctgccgtagctgcggaatcttccacaggcacatggacc
acggtatggaccgatctgctgaccgatttggactactataagggccgtgcgtataagatt
gaggatgtacctggggatgacacctgtttttacgcttttgtagcttacccgattgatctt
tttgaagaaggttccgtcgttaacgtgttgacctccctggtaggtaacgtgtttggcttt
aaagcgttgcgcgcactacgcctggaagatgtccgcttcccgattgcttatgtcaaaacc
tgcggcggacctcctgccggtattcaggtagaacgcgatcgttttaacaaatatggccgc
gcactgttaggttgtaccattaagcccaaactaggcctatccgccaaaaactatggccgt
gccgtatacgaatgtctgcgcggcggactggatctgaccaaggacgacgaaaacattaac
agtcaacctttcatgcgctggcgcgatcgtttccaattcgtggtggaagcttgccaaaaa
gccgagcgtgaaaccggagaacgtaaaggtcactaccttaacgtaacagcaccaaccccg
gaagaaatgtacaaacgagcagaattcgccaaagaattgggtgcaccgatcattatgcat
gactacttgacaggtggtttaaccgccaatacaggtttggctaactggtgtcgcaataac
ggaatgctactgcacatccatcgtgccatgcacgccgtgctcgatcgcaacccacaccat
ggtattcatttccgcgttttaaccaaagtgctacgtttgtcgggtggcgatcatctgcat
tccggtaccgtggttggtaaactggaaggtgaccgtgcagcaaccctcggttggatcgac
acaatgcgcgataaattcatcaaagaagaccgcagccgtggcctgttcttcgatcaagat
tggggctctatgccaggtgtattcccggttgcttcaggtggtattcacgtttggcatatg
ccagcgctggtcgcgatctttggtgacgacgcctgtttgcagtttggtggcggtaccttg
ggtcatccatggggtaacgctgcgggcgctgccgctaaccgcgtcgcactggaagcctgc
gtggaagcacgtaaccaaggcgttgaaatcgagaaagaaggcaaagctattctgaccaaa
gcagccaaaagcagccctgaactgaaaatcgccatggaaacatggaaagagatcaagttc
gagtttgatacggttgataaactggacatagctcacaagtaa

DBGET integrated database retrieval system