KEGG   Nitrosomonas sp. AL212: NAL212_1133Help
Entry
NAL212_1133       CDS       T01443                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
nit  Nitrosomonas sp. AL212
Brite
KEGG Orthology (KO) [BR:nit00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:nit03012]
    NAL212_1133
   03029 Mitochondrial biogenesis [BR:nit03029]
    NAL212_1133
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nit04147]
    NAL212_1133
Translation factors [BR:nit03012]
 Eukaryotic Type
  Elongation factors
   NAL212_1133
 Prokaryotic Type
   NAL212_1133
Mitochondrial biogenesis [BR:nit03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    NAL212_1133
Exosome [BR:nit04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   NAL212_1133
  Exosomal proteins of breast cancer cells
   NAL212_1133
  Exosomal proteins of colorectal cancer cells
   NAL212_1133
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 AAA_23 RsgA_GTPase cobW VIT_2
Motif
Other DBs
NCBI-ProteinID: ADZ26043
UniProt: F9ZFE7
LinkDB All DBs
Position
1060636..1061826
Genome map
AA seq 396 aa AA seqDB search
MAKSKFERSKPHVNVGTIGHVDHGKTTLTAAITTILTKKFGGEAKSYDQIDSAPEERARG
ITINTAHVEYETDKRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVGVPYIIVYMNKADMVDDAELIELVEMEIRELLSKYDFPGDDTPIIVGSALKALE
GDQSDIGEASILKLADALDSYIPQPERAIDGAFIMPVEDVFSISGRGTVVTGRVERGIIK
VGEEIEIVGLKPTLKTVCTGVEMFRKLLDQGQAGDNVGILLRGTKREEVERGQVLAKPGS
ISPHTKFTAEIYVLSKEEGGRHTPFFPGYRPQFYFRTTDVTGAIELPAGTEMVMPGDNVS
VTVNLIAPIAMEDGLRFAIREGGRTVGAGVVAKIIE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagagtaaatttgagcggtcgaagccacatgtgaatgttggaacgatagggcac
gtggatcatggtaagactacgcttacggcagcaattacgacgatattgacgaagaagttt
ggtggagaagcgaagagttatgatcaaattgattctgcgccggaagaacgtgcgcgcggg
ataaccataaacacagctcatgttgaatatgagacggataagcgtcattatgctcatgtg
gattgtccgggccatgcggattacgtaaagaatatgattacgggagcggctcaaatggat
ggagcgatattggttgtgtctgcagccgatggtccgatgccgcagacgcgagaacatatt
ttgttggcgcgtcaagtgggtgttccttacatcattgtgtacatgaataaagcagacatg
gttgatgatgctgagctgattgaattggtggaaatggagatacgtgagctgctatcgaaa
tatgattttccaggtgatgatacgccgattatagttggatcggcgttgaaagcgcttgag
ggtgatcaaagtgatattggtgaggcttccattctgaaattggcagatgcgctggatagt
tatattccacaaccggagcgtgctattgacggtgcctttattatgccggttgaagatgta
ttttcaatatctggtcgcggaactgttgtaacgggtcgtgtagagagaggcataatcaaa
gtgggtgaagagatcgagatagtgggtctcaagccgacactaaagacagtatgcacgggg
gttgaaatgtttcgtaagcttctggatcaagggcaggcaggagacaacgttgggatactt
ttgcgtggtacgaagcgtgaagaggtggagcgaggtcaagtattggcgaagccgggcagc
atatcaccccatactaaattcacggcggagatttatgtattaagtaaggaagaaggtgga
aggcatactccgttttttcccggctatcgaccccaattttattttagaacgacagatgtg
acgggagcgatagagttgccagcgggaacagagatggtgatgcctggggataatgtttcg
gtgacggtaaacttaatagcgccaattgcgatggaagacggattacgttttgcgatacgt
gaaggtggaagaactgttggtgcaggcgttgtggctaaaattattgagtga

DBGET integrated database retrieval system