KEGG   Nitrosomonas sp. AL212: NAL212_1518Help
Entry
NAL212_1518       CDS       T01443                                 

Definition
(GenBank) queuosine biosynthesis protein QueD
  KO
K01737  6-pyruvoyltetrahydropterin/6-carboxytetrahydropterin synthase [EC:4.2.3.12 4.1.2.50]
Organism
nit  Nitrosomonas sp. AL212
Pathway
nit00790  Folate biosynthesis
nit01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nit00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    NAL212_1518
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:nit03016]
    NAL212_1518
Enzymes [BR:nit01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.50  6-carboxytetrahydropterin synthase
     NAL212_1518
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.12  6-pyruvoyltetrahydropterin synthase
     NAL212_1518
Transfer RNA biogenesis [BR:nit03016]
 Prokaryotic type
  tRNA modification factors
   Other tRNA modification factors
    NAL212_1518
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTPS TATR VP9
Motif
Other DBs
NCBI-ProteinID: ADZ26399
UniProt: F9ZIY1
LinkDB All DBs
Position
1459775..1460224
Genome map
AA seq 149 aa AA seqDB search
MLITRKLEFDAGHRISTHNSQCRHLHGHRYCIEITLSGNIIADEGVAQQGMVMDFAAVKQ
IAKSTLVDYWDHAFLVYSGDKKVLQFLQSIEDHKTVVLDVQPTAENLALIAFNILDDAYQ
DSYGNHLQLEQVRLFETPNCWADAVRGAR
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgttaattacacgcaagttggaatttgacgcaggccatcgcatttcaacacataacagc
caatgccgacatttacacggacatcgctattgtattgaaattaccttgtcgggtaacatt
atcgctgacgaaggcgtagcacagcaaggcatggtcatggattttgccgcagtgaagcaa
attgccaaatccactttggtggattactgggatcatgcattcctggtttattccggggat
aagaaagttttgcaattcttgcaatcgattgaagatcataaaacggttgtgctggatgtt
cagcctaccgcggagaatctggcgttgatcgcttttaacattttagatgatgcttaccag
gatagctatggcaaccatctgcaattagagcaggtgcgcttgtttgaaacgcccaattgc
tgggccgatgcagtgcgcggagcacggtaa

DBGET integrated database retrieval system