KEGG   Nitrosomonas sp. AL212: NAL212_1550Help
Entry
NAL212_1550       CDS       T01443                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
nit  Nitrosomonas sp. AL212
Brite
Enzymes [BR:nit01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     NAL212_1550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ADZ26431
UniProt: F9ZJP5
LinkDB All DBs
Position
complement(1491214..1491855)
Genome map
AA seq 213 aa AA seqDB search
MTNVNLDNFSQAAQSGTQYVLAPLPYSDTALQPVISSNTLSFHYGKHHKTYVDNLNNLLA
NSDLAGQSLEQIIKATAGQTEKAAIFNNAAQVWNHMFYWHSLKPNGGGEPSSTLKQKIEA
SFGSLEACKKEFAQAALTQFGSGWAWLVQDGDKIALVKTGNAETPLTKNVRPLLTIDVWE
HAYYLDYQNRRADYANAILEKLINWDFAAANLG
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatgtcaatcttgacaatttttcccaagcggcacaatccggaacgcagtatgtc
ctggccccattgccttattcggatactgcgctacaacctgtgatatcttcaaatacactg
agttttcactatggcaaacatcacaaaacctatgtcgacaacttgaataatctgctggca
aacagcgatctggcagggcaatccttggagcaaatcatcaaggcaaccgccgggcaaacg
gaaaaagccgcgattttcaataatgccgcacaagtctggaatcatatgttctattggcat
agtttgaagcccaatggcggcggggaaccctcatcgaccctgaaacaaaaaattgaagct
tcattcggcagtctggaagcttgcaaaaaagaatttgctcaagctgcattgactcagttt
ggaagcggttgggcatggctggttcaggatggcgataaaatcgccttagtcaaaaccggc
aacgccgaaaccccgctgacaaaaaatgtccggccattattgactattgatgtttgggag
catgcttactatctggattatcaaaatcgccgtgccgattatgcgaacgcaattctggag
aaattgatcaattgggattttgctgcagctaatcttgggtaa

DBGET integrated database retrieval system