KEGG   Nitrosomonas sp. AL212: NAL212_1785Help
Entry
NAL212_1785       CDS       T01443                                 

Definition
(GenBank) succinate dehydrogenase and fumarate reductase iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
nit  Nitrosomonas sp. AL212
Pathway
nit00020  Citrate cycle (TCA cycle)
nit00190  Oxidative phosphorylation
nit00650  Butanoate metabolism
nit01100  Metabolic pathways
nit01110  Biosynthesis of secondary metabolites
nit01120  Microbial metabolism in diverse environments
nit01130  Biosynthesis of antibiotics
nit01200  Carbon metabolism
Module
nit_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nit_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
nit_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:nit00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NAL212_1785
   00650 Butanoate metabolism
    NAL212_1785
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    NAL212_1785
Enzymes [BR:nit01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     NAL212_1785
    1.3.5.4  fumarate reductase (quinol)
     NAL212_1785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_10 Fer4_8 Fer4_9 Fer4_18 Fer4_4 Fer4_7 Fer4
Motif
Other DBs
NCBI-ProteinID: ADZ26651
UniProt: F9ZD68
LinkDB All DBs
Position
complement(1736768..1737463)
Genome map
AA seq 231 aa AA seqDB search
MKFSIYRYDPDKDEKPYMQDYDVQLTATDKMLLDALLRIKSIDDSLSLRRSCREGVCGSD
AMNINGRNGLACITPLKSLKEPVEIRPLPGLPVIRDLIVDMTQFFQQYHSIKPYLINNDP
PPETERLQSPEERAALDGVYECILCACCTTSCPSFWWNPDKFVGPAGLLQAYRFLADSRD
QATAERLDDLEDPYRLFRCHSIMNCVDACPKGLNPTQAIGKIKDMMVKRMV
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgaagttttcaatttaccgctatgatcccgataaagatgaaaaaccatacatgcaggat
tacgacgttcagttgactgcgacggataaaatgctattggatgcattgttgcgaatcaaa
tcgattgatgatagtttgagtttacgccgttcctgccgtgaaggcgtgtgcggatcggat
gcgatgaatatcaacggacgaaatggattggcgtgcataacaccacttaaaagcctgaaa
gaaccagttgaaatacggccattacctggattgccggtgattcgtgacctgatcgtggat
atgacgcaatttttccagcaataccattcgatcaaaccttatttgatcaataatgatcca
ccgcctgaaacggaacggttacagtcgccggaagaaagggctgcattggatggtgtctat
gagtgcattttatgtgcttgctgcactacttcctgtccttccttttggtggaatccggat
aaatttgtcgggcccgcgggattattgcaggcctatcgttttctcgccgatagtcgcgat
caggcaacggctgagcgcttagatgatttggaagatccttatcggctgtttcgctgtcat
tccatcatgaattgtgttgatgcatgccctaaaggtttgaatccaacccaggcaatcggc
aaaatcaaagacatgatggttaagagaatggtatga

DBGET integrated database retrieval system