KEGG   Nitrosomonas sp. AL212: NAL212_2233
Entry
NAL212_2233       CDS       T01443                                 

Definition
(GenBank) DNA polymerase III chi subunit HolC
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
nit  Nitrosomonas sp. AL212
Pathway
nit03030  DNA replication
nit03430  Mismatch repair
nit03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:nit00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    NAL212_2233
   03430 Mismatch repair
    NAL212_2233
   03440 Homologous recombination
    NAL212_2233
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:nit03032]
    NAL212_2233
   03400 DNA repair and recombination proteins [BR:nit03400]
    NAL212_2233
Enzymes [BR:nit01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     NAL212_2233
DNA replication proteins [BR:nit03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     NAL212_2233
DNA repair and recombination proteins [BR:nit03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     NAL212_2233
SSDB
Motif
Pfam: DNA_pol3_chi
Other DBs
NCBI-ProteinID: ADZ27060
UniProt: F9ZFV2
LinkDB
Position
2215388..2215867
AA seq 159 aa
MTFFSYKFNALIAMTQILFYSGSNNKLQTTCRLCAKAIQQHMRVLIYVPASKLLDQLDQL
LWTFSSTSFIPHCNILDDAKLVSATPVILSGQIQVNSPFDVLINLHDQSPHLFDQFDRLI
EIAGTSHEDKLAARERYRFYKNAGYEIQHYHLNDQSEPH
NT seq 480 nt   +upstreamnt  +downstreamnt
atgacgttcttttcgtataaattcaatgcgttgatcgctatgacacagattcttttctac
tcgggatcaaacaataaattgcaaacaacttgccggctttgtgccaaggcaatacaacag
catatgagagtattgatttacgtgcctgcatcaaaattgttggaccagctagatcaatta
ctatggacattctcatctaccagctttattccgcattgtaatattctggacgatgctaaa
ttagttagcgcaacaccggtgattctgagtgggcaaattcaagtcaactccccgtttgat
gtgttaatcaatctgcatgatcaatctccacacttattcgatcaattcgaccgcttaatc
gagatcgcaggcacttctcatgaggataagctggcagcacgcgaacgttaccgtttttat
aagaatgccggttacgagatacagcactaccatttaaacgatcaatccgaaccacattaa

DBGET integrated database retrieval system