KEGG   Nitrosomonas sp. AL212: NAL212_2942Help
Entry
NAL212_2942       CDS       T01443                                 

Definition
(GenBank) Ribulose-bisphosphate carboxylase
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
nit  Nitrosomonas sp. AL212
Pathway
nit00630  Glyoxylate and dicarboxylate metabolism
nit00710  Carbon fixation in photosynthetic organisms
nit01100  Metabolic pathways
nit01120  Microbial metabolism in diverse environments
nit01200  Carbon metabolism
Module
nit_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:nit00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    NAL212_2942
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    NAL212_2942
Enzymes [BR:nit01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     NAL212_2942
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: ADZ27727
UniProt: F9ZKP6
LinkDB All DBs
Position
2931352..2932827
Genome map
AA seq 491 aa AA seqDB search
MASQTMKEGKERYKSGVIPYKKMGYWEPAYVPKDTDVIAMFRITPQPGVDHEEAAAAVAG
ESSTATWTVVWTDRLTACELYRAKAYKSELVPNTGPGTDNEAQYFAYIAYDIDLFEEGSI
ANLTASIIGNVFGFKAVKALRLEDMRIPVAYLKTFQGPATGIVVERERLDKFGRPLLGAT
TKPKLGLSGRNYGRVVYEGLKGGLDFMKDDENINSQPFMHWRDRFLYCMEAVNKASAATG
EVKGHYLNVTAGTMEDMYERAEFAKSLGSVIVMIDLVIGYTAIQSMAKWARRNDMILHLH
RAGNSTYSRQKNHGMNFRVICKWMRMAGVDHIHAGTVVGKLEGDPLMIKGFYDTLRETRT
EKSLEHGLFFDQDWASLNKCMPVASGGIHAGQMHQLIDYLGEDVILQFGGGTIGHPQGIQ
AGAVANRVALEAMIMARNEGRDYVKEGPQILADAAKWCTPLKQALDTWKDITFNYDSTDT
ADFVPSTTANA
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggcttcacaaacgatgaaagaaggtaaggaacgttacaaatcaggcgttattccgtac
aaaaaaatgggttattgggaacctgcctatgtacccaaagacacggatgttatcgccatg
ttccgtattacaccacaacccggtgtggatcatgaagaagctgcagctgcagttgctggc
gaatcttccaccgcgacctggaccgtagtatggactgaccgactaaccgcttgcgagctt
tatcgtgccaaagcctataagtctgagctggtacccaacacaggcccgggtactgataac
gaagcgcaatactttgcctatatcgcctatgacatcgatttattcgaagaaggctcgatc
gcaaacttaaccgcgtccattatcggtaacgtgtttggcttcaaagcggtcaaggcgctg
cgtcttgaagatatgcgcattcccgtggcttacctgaaaacttttcaaggtcctgcaacg
ggtatcgtggttgaacgtgaacgcttggataaattcggtcgccccttgcttggcgccacc
accaaacctaaattaggtctctcgggcagaaactatggccgcgtggtttacgagggactt
aaaggcggtctggatttcatgaaggatgacgaaaatattaattcgcagccttttatgcat
tggcgcgaccgcttcctgtattgcatggaagcagtgaacaaggcctcagccgcaaccggt
gaagtcaaagggcattatttgaatgttaccgccggcaccatggaagacatgtatgaaaga
gcggagtttgcaaagtctctgggttcagtcatcgtcatgatcgatttggtgatcggttat
actgcgattcaatcgatggcgaaatgggcacgcaggaacgacatgatattgcacttgcat
cgcgcgggtaattcgacttattcacgccaaaaaaatcacggcatgaatttccgcgtaatt
tgtaagtggatgcgtatggcgggtgtcgatcatattcacgcaggcacagttgttggtaag
ctggaaggtgatccactcatgatcaaaggtttttacgatactttacgcgaaacacgtact
gaaaaaagcttggaacatggattattctttgatcaggactgggcatcattgaataaatgt
atgccggttgcttccggtggtattcatgcaggccaaatgcatcagttgatcgattatctc
ggagaagatgtaatactgcagttcggtggcggtaccattggacaccctcaaggcattcag
gctggggcagtagcaaaccgtgtagcactcgaagctatgattatggcgcgtaatgaaggt
cgggattacgtaaaagaaggcccgcaaattcttgcagacgctgcgaaatggtgcacaccg
ctcaaacaagcattggatacgtggaaagatatcacttttaactacgactccacggatacc
gctgattttgtgccatccacaactgcaaacgcttaa

DBGET integrated database retrieval system