KEGG   Nitrosomonas sp. AL212: NAL212_2943Help
Entry
NAL212_2943       CDS       T01443                                 

Definition
(GenBank) Ribulose-bisphosphate carboxylase
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
nit  Nitrosomonas sp. AL212
Pathway
nit00630  Glyoxylate and dicarboxylate metabolism
nit00710  Carbon fixation in photosynthetic organisms
nit01100  Metabolic pathways
nit01120  Microbial metabolism in diverse environments
nit01200  Carbon metabolism
Module
nit_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:nit00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    NAL212_2943
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    NAL212_2943
Enzymes [BR:nit01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     NAL212_2943
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small Ntox17
Motif
Other DBs
NCBI-ProteinID: ADZ27728
UniProt: F9ZKP7
LinkDB All DBs
Position
2932848..2933282
Genome map
AA seq 144 aa AA seqDB search
MMTNQGNLLTQGQFSFLPPLTDKQISAQLKYALKNGWAIGIEYTDDPHPRNTYWEMFGNP
MFDLKDPAGILLEINSCRKTFPNHYIRVTAFNSTRGVESPTMSYIVNRPKKEPGFSLVRQ
EGAGRSVSYTIHSYATDKPEAERY
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgatgaccaatcaagggaatttacttacacaggggcaattctcttttctgcccccgctg
accgacaagcaaatttccgcacagcttaagtacgcgctgaaaaatggctgggcaatagga
attgaatacaccgatgatcctcatccacgcaatacctattgggaaatgttcggcaatcca
atgtttgatttgaaggatccggcaggaattttgctggaaatcaatagttgccgcaaaact
tttccaaaccattatattcgcgtgactgcatttaactcgacccgcggggtggaaagccca
accatgtcgtatattgttaaccggcccaagaaagaacccgggtttagtttagtacgccag
gaaggtgccggacgaagcgttagttacaccattcattcctatgcaaccgacaaaccggaa
gccgaacggtactag

DBGET integrated database retrieval system