KEGG   Nitrospira japonica: NSJP_1206Help
Entry
NSJP_1206         CDS       T05001                                 

Definition
(GenBank) Manganese and iron superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
nja  Nitrospira japonica
Brite
Enzymes [BR:nja01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     NSJP_1206
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: SLM47378
UniProt: A0A1W1I2Z7
LinkDB All DBs
Position
I:complement(1152413..1153048)
Genome map
AA seq 211 aa AA seqDB search
MPHFPPYRVKSFNLHGLQGISDKTVDLHLSLYEGYVKATNALQGRIAEFLKDGSVDQEEM
PAYSELTRRLGFEYNGMVLHEHYFENLSSQASLKPEGSSAFRRRAEASFDSFDRWQADFS
SVGKMRGVGWAICFQDPESGRLTNHWVTLHEHGNVAGFAPVLVMDVWEHAYLLDYAPSQR
AQYIDAFFSNINWRIVDRRVEDTERLRKRAA
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgccgcacttccctccctatcgcgtgaagtccttcaacctgcacggcttacaaggcatc
tcggacaaaaccgtcgacctccacctctcgctctatgaagggtatgtcaaggcgacaaat
gccttacaagggcgtatcgccgaatttctcaaggacggatcggtagaccaggaagaaatg
ccggcctattccgaactgacgcgccgcctcggcttcgagtacaacggcatggtcctccac
gagcattattttgagaacctcagttcccaagcctctctgaagccggagggctcatccgcc
tttcgccgacgagcggaggcctcgttcgacagctttgatcgctggcaagcggatttctcc
agcgttggaaagatgagaggggtcggctgggccatctgtttccaggatccggagagcggt
cgactgacgaaccattgggtgaccctgcacgagcatggcaacgtggccggctttgcgccc
gtcctcgtcatggacgtctgggaacatgcctatctcttggattatgccccgtcccaacgg
gcgcaatatatcgatgccttcttctccaacatcaattggcgcattgtggatcgtcgggtg
gaggatacggagcgacttcgcaagcgcgccgcatga

DBGET integrated database retrieval system