KEGG   Niastella koreensis: Niako_0717Help
Entry
Niako_0717        CDS       T01679                                 

Definition
(GenBank) Glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
nko  Niastella koreensis
Pathway
nko00564  Glycerophospholipid metabolism
nko01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nko00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Niako_0717
Enzymes [BR:nko01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Niako_0717
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored GIDA NAD_binding_8 Pyr_redox_2 HI0933_like Pyr_redox_3 CaATP_NAI
Motif
Other DBs
NCBI-ProteinID: AEV97100
UniProt: G8TBJ0
LinkDB All DBs
Position
854178..855752
Genome map
AA seq 524 aa AA seqDB search
MEADTVQNRNALVNRLGTQKEWDLIVIGGGATGLGIALEAVSRGYSALLVEQADFAKGTS
SRSTKLVHGGVRYLAQGDIQLVREASIERGLLWRNAPHLVKNQTFIIPIYTWWDRLKYTI
GLKLYDWIAGRLSLGASVFIPRNKALFKLPNIKSKGLVGGVQYHDGQFDDSRLAINLVQT
IIEKGGVALNYMKVTGLIKDNGQHISGVTVKDIETSQTYTCKAKAVVNATGVFVDDILQL
DNPTGTKSITASQGVHLVLDKRFYPADDALMIPATSDGRVLFAVPWHGKVVVGTTDTPVK
EASLEPQALEKEINFILENAANYLVEQPKRSDVLSVFAGLRPLAAPQGGKQKTKEISRSH
KIMVTPSQLFTILGGKWTTFRKMGEDMVDRVEKELQWPHKETGTRHLQIHGAMANVNIHD
PLYFYGSDTAGVKALMNGHANQWLSNSLQIHEAQVIWAVQHEMARTVEDVLSRRTRALLL
DARESIRMAEPVAVIMAKQLGKDEVWIREQVALYTKLAERYVLS
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atggaagctgataccgtacaaaatcgtaacgcgctggtaaaccggctgggaacgcaaaag
gagtgggacctgatagtaattgggggcggagcaactggcttaggcattgctttagaagcc
gttagcaggggatacagcgcattgctggtggaacaggctgattttgccaaaggcacttcc
agccgcagcaccaaactggtgcatggcggggttcgttacctggcacagggtgatattcaa
ctggttagagaagccagcattgagcgggggctgttatggcgcaatgctccccacctggta
aaaaatcaaactttcattattcctatttatacctggtgggaccggctcaaatataccatc
gggttgaagttatatgattggattgcgggccggctgagcctgggggcgtcggtttttatt
ccgaggaacaaagcattatttaaacttccaaacataaagtctaaaggtttggtgggcggt
gtgcagtatcacgatggtcagttcgatgattcgcgcctggctattaacctggtgcaaacg
atcattgaaaagggcggggtggcgctgaactatatgaaagtgaccggtcttataaaagac
aatggtcagcacatttcaggagttaccgtaaaagatattgaaaccagtcaaacctatacc
tgcaaggcgaaagcagtggtgaacgccaccggcgtgtttgtagatgacatcctgcagctg
gataacccaaccggtacaaaaagtattacggccagtcagggtgtacacctggtgctggat
aaaagattttacccggccgatgatgccctcatgatcccggctaccagtgatggacgggtg
ctgtttgccgtgccctggcacggaaaggtggtggtgggtactacagataccccggtgaag
gaagcttcgctggaaccgcaggcccttgaaaaagaaatcaatttcatcctggagaacgca
gccaattacctggtggagcagccaaaacgcagcgacgttttaagcgtttttgccgggtta
cgtccactcgcagctccacagggcggtaaacaaaaaacaaaagagatctcgcgcagtcat
aagatcatggtaacgccttcgcaactgtttaccattttaggtggtaaatggaccaccttc
cgcaaaatgggcgaagatatggttgaccgggtagagaaggaattgcagtggccgcataaa
gaaaccggtacccgccatttgcagatccatggcgcaatggccaatgtaaacatacacgat
cctttatatttctatggcagtgatactgccggcgtaaaagcgttgatgaatggccatgcc
aaccaatggctgagtaacagtttacaaattcacgaagcgcaggtgatctgggccgtgcag
cacgaaatggcgcgcacggtggaagatgtgttatcgcgccgtacaagagctttattactc
gatgcccgcgaaagcattcgcatggcggagcccgtagcagttattatggcgaagcagctt
ggtaaagatgaagtttggattcgtgaacaagttgctttatatacgaaactggctgagcgg
tatgtgttgagctag

DBGET integrated database retrieval system