KEGG   Niastella koreensis: Niako_1659Help
Entry
Niako_1659        CDS       T01679                                 

Definition
(GenBank) Glycoside hydrolase 97
  KO
K21574  glucan 1,4-alpha-glucosidase [EC:3.2.1.3]
Organism
nko  Niastella koreensis
Pathway
nko00500  Starch and sucrose metabolism
nko01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nko00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Niako_1659
Enzymes [BR:nko01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     Niako_1659
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_97 GH97_N GH97_C
Motif
Other DBs
NCBI-ProteinID: AEV98026
UniProt: G8T875
LinkDB All DBs
Position
2042545..2044647
Genome map
AA seq 700 aa AA seqDB search
MMKPGIVLIFLLFSVVTFANPPLEISREKVKLQFFIDEQGRPVYAVLFNGRDVVKPSALG
FMLETDSLFYKNFSLVNVDRKVVDETWKPVWGECSTIRNNYEQLTVHLKHGSGKLLDIVF
RVFADGVGFRYEFPRQNSLVYFVVKEECTQFHLAGNHKAFWIPGDFDTNEYAYTTSLLSE
VNNTPVVQTATDIAVRTVTDSLAVQTPLMMKTGDGLYINIHEAALLNYPAMQLHVDKKDF
VLSSNLVPDAYNNKAYLHAPAHTPWRTILVSDKATDILASKTILNLNDPPVQQDLSWIKP
MKFVGVWWEMQTGKSTWNYSDYADSTNANGQLIPNGRHGANTINVKRYIDFAAKNKIGGV
LVEGWDKGWEDWFGNWKENVFDFVTPYPDFDVKEITAYARSKGVAMIMHHETSGSATNYD
RQLDTAFRFMQQFGYPAVKTGYVGRIVPRGEHHDGQWMVNHYERVLQQGMRYHVMVDAHE
PPRPTGLQRTYPNFMACEAARGNEYHAFSNGNAPDHETILPFTRLMGGPMDYTPGIFKLK
GYAPGMPDRSVHSTLTKQLALYVTLYSPVEMAADLPENYEAKPDAFQFIKDVPVDWDDTK
ILEAEPGDYVTIARKGKGTNNWFIGAITDEHARTTTLLLNFLEKGKKYNATIYEDGAGAD
WKTNPEAYSIKTIAVDSTTKLKLTLAAGGGTAISIMQTGQ
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaacctggaattgtattaatattcctgttattttccgttgtgacttttgccaat
ccaccattggagataagcagggaaaaagtgaagctgcagttttttatagatgagcagggg
cggccggtgtatgctgttttgttcaatggccgcgatgtggtgaaaccctctgcgttgggt
tttatgctcgaaaccgattccctgttttataaaaacttttccctggtaaacgttgaccgg
aaagtagtggatgaaacctggaaaccggtttggggcgagtgcagtactattcgcaacaac
tatgaacagcttaccgttcacctgaagcatggttcaggaaaactgctggatattgtgttt
cgcgtttttgccgatggagtagggttccgttatgaatttccccggcaaaacagccttgtt
tattttgttgtaaaggaagagtgcacgcagtttcatttggccggtaaccataaggcattc
tggatccccggcgattttgataccaatgaatatgcgtataccacttcgctgctcagcgaa
gtaaacaatacgccggttgtgcagactgctactgatattgccgttcgtacggtaaccgat
tcgctggcggtgcaaaccccactgatgatgaaaacgggtgatggcctctatatcaatatt
catgaagctgcgctgctgaattacccggccatgcaattgcatgttgataagaaggacttc
gttttgtcatcgaacctggtgccggatgcctataataacaaagcctatctgcatgcaccc
gcgcatacaccctggcgtactattctcgtaagtgataaagcaaccgacatcctggcatca
aaaacgatcctgaacctgaacgacccaccggttcagcaggatctgtcgtggataaaaccc
atgaagttcgtaggcgtgtggtgggaaatgcaaaccggcaaaagcacctggaattattct
gactatgccgatagcaccaatgccaatgggcagctgatccctaatggccggcacggcgcc
aataccatcaatgtaaaacggtatattgattttgctgcaaagaacaagatcggtggcgta
ctggtagaaggctgggacaaggggtgggaagactggtttggcaactggaaggaaaatgtg
tttgattttgttacgccatatcctgattttgatgtaaaggaaattacggcgtatgccaga
tcaaaaggcgtcgcgatgatcatgcaccatgaaacgtcgggctctgctaccaattacgac
cggcagctggatacggctttccggttcatgcaacagtttggttatcccgcggtgaaaacg
ggatatgtgggccgcattgttccgcggggcgaacaccacgatggacaatggatggtaaat
cattatgaacgggtgctgcaacagggcatgcgctatcatgtaatggtggatgcgcatgaa
ccgccaagaccgacaggcctgcaacgcacttatccaaacttcatggcctgcgaagcggcc
cggggtaatgaataccatgccttcagcaatggcaatgcacccgatcatgaaaccatttta
ccattcacccggttaatgggcggaccaatggattatacccccggtatttttaaactaaag
ggttatgcgcctggcatgccagaccggtcagtgcactccaccctgaccaagcaactggcg
ttgtatgttacgttatacagtccggttgaaatggcggccgatctgccggagaattatgag
gccaaacccgatgcctttcagtttataaaggacgttccggttgattgggacgataccaaa
atcctggaagccgaaccgggcgattatgtaaccattgcccgcaagggaaagggaacaaac
aactggttcattggcgctattaccgatgagcatgcacgaacaacaacgctcttattaaac
ttcctggagaaaggaaaaaaatacaatgcaactatttatgaagatggcgcaggcgctgac
tggaaaacaaatcccgaagcctattccatcaaaactatagcggttgatagcactaccaaa
ctgaagcttaccctcgctgcgggcggcggaacagccatcagtattatgcagactggacag
tag

DBGET integrated database retrieval system