KEGG   Niastella koreensis: Niako_4558Help
Entry
Niako_4558        CDS       T01679                                 

Definition
(GenBank) Kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
nko  Niastella koreensis
Pathway
nko00380  Tryptophan metabolism
nko01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nko00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    Niako_4558
Enzymes [BR:nko01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     Niako_4558
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 DegT_DnrJ_EryC1 SHMT PDZ
Motif
Other DBs
NCBI-ProteinID: AEW00816
UniProt: G8TKX7
LinkDB All DBs
Position
complement(5690314..5691600)
Genome map
AA seq 428 aa AA seqDB search
MIFENSHSFAYVLDEQDELRSFREQFIMPVIDGKQQIYFLGNSLGLQPKRTNDYLQQVLN
KWANYGVEGFFMGEQPWLQYHDHLTKPLSTIVGALPHEVVAMNQLTVNLHLLLVSFYNPH
GKRNKIICEAKAFPSDQYMLETHVKYCGFNPDDVIVEVGPRKGEHTIRHEDILQAIQQHK
DELALVLWGGMNYYTGQLFDMAAITKAAQAVGAKVGFDLAHAAGNVPLQLHNWNVDFAAW
CSYKYMNSGPGGIGGAYIHERYHNDTSLPRFAGWWGYDKATRFLMQKGFNATRSAEGWQL
STPSPLLYAAHRAALDLFMEAGFNRLQNKRQLLNKWLWFLLDDLNNAQTEPVVEFITPRN
EAERGCQVSMLMLQQGKQVFDELARAGVIVDWREPNVIRLAPVPLYNSFEEVWQFTNILR
QILQLQHA
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgatttttgaaaactctcattcatttgcgtatgttcttgatgagcaggatgaactgcgt
tcgttccgggagcaatttataatgcctgtaattgacggaaagcagcagatctatttcctg
ggtaactccctgggcctgcaacccaaacgcaccaacgactacctgcaacaggtgctgaac
aaatgggccaactatggcgtggaaggcttttttatgggtgaacaaccctggctgcaatac
cacgaccatcttaccaaaccactgtcaaccattgtaggcgccttgccgcatgaagtggtg
gccatgaaccagcttacggtgaacctgcatttgctgctggtatctttttacaatccccat
ggtaaacggaacaagatcatttgtgaagccaaagcatttcccagcgatcagtatatgctg
gaaacgcatgtaaaatattgtggctttaatccggatgacgtgattgttgaagtgggcccc
cgcaaaggcgagcataccattcgccatgaagacattctgcaggccatacaacaacataaa
gacgaactggccctggttttgtggggcgggatgaattattataccggccagctgtttgat
atggcggccattaccaaagcggcgcaggccgtgggcgccaaagtagggttcgacctcgcg
catgcagcagggaatgttcctttgcagctgcacaactggaatgtggattttgccgcctgg
tgcagttataaatatatgaactctggtcccggtggtattggtggcgcctatattcatgaa
cgttaccataacgataccagcttaccacgttttgcaggctggtggggctacgataaagcc
acccgcttcctgatgcagaaagggttcaatgccacccgttcggccgaaggctggcagcta
agtacgccctcgccgctgttgtatgcagcacaccgggcggcgctggacctgtttatggaa
gcaggcttcaacaggctgcaaaataaaagacagttattgaacaaatggttatggttcttg
ctcgatgatttgaacaatgcgcagacagaaccggtggttgaatttattacgccccgcaat
gaggccgaaagaggctgccaggtgtctatgttaatgttgcaacagggcaagcaggtattt
gacgaactggcccgggcgggagttatagtagactggcgcgaacccaatgtaataaggctg
gcgcccgtacctttgtacaacagtttcgaggaagtatggcaattcactaatatcttgcga
caaattttacaactccaacacgcatga

DBGET integrated database retrieval system