KEGG   Niastella koreensis: Niako_4922Help
Entry
Niako_4922        CDS       T01679                                 

Definition
(GenBank) DNA ligase D
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
nko  Niastella koreensis
Pathway
nko03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:nko00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    Niako_4922
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:nko03400]
    Niako_4922
Enzymes [BR:nko01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Niako_4922
DNA repair and recombination proteins [BR:nko03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Niako_4922
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase mRNA_cap_enzyme DNA_ligase_OB_2
Motif
Other DBs
NCBI-ProteinID: AEW01162
UniProt: G8T7C6
LinkDB All DBs
Position
6072757..6074811
Genome map
AA seq 684 aa AA seqDB search
MAVTSQRKKKTVGVRRRKSAAPTGKAGVKAPFPTGFAPMLATLVDKPFDADNWLFEVKWD
GYRAVAHCDGKQVSVISRNNKSFNEKFYPITAALEELNLHAVLDGEIIISNKEGVSSFGD
LQNWRSEADGELLYYVFDLLWLNGYLLIDLPLQQRRDILKKMLPQHPTIQLSQSFEAPGT
QFYEMAKEMNMEGIIAKKADSVYVPGVRSKDWLKIKIAKRQEVVIGGYTHNEGSSKLFSS
LLVGVFENGVLHYTGKIGTGFTDKDQRDMMEQFKPLVRKSCPFGTEPDYNKPSRFRPNPP
KATAIWLKPQLVCEVAFAEITSDGVMRHPSFEGMRIDKKATDVKAEKARPLKIVAPESIL
HKEKILTRRSAAERKTLLNPGEKQQERSINGYKLKFSNLNKIYWPKEKITKRDLLNYYYQ
VSPVILPYLKDRPQSMNRFPNGIDGESFYQKNVTGKIPDWINTFPYTDKSVKKSFLVPVR
EADVLYMASLGCIEMNPWSSRVQKPDNPDWCIIDLDPDTNTFEQVIKTAQVTHELLDSAG
IPNYCKTSGSTGIHIYMPLGAKYVYEASREFGRLIATMVHEQLPRFTSIERQTADRKGKI
YIDFLQNRPQATLACAYSLRPKPGATVSMPLHWEEVKKGLKMKDFTIHNAVARIKEQGDI
FKPVLGKGINMKKAIESLQKLLHS
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
atggcagttacttcacaaaggaagaaaaagactgttggggtacgccggcgcaaaagcgcg
gcgcccaccggtaaagcaggggtaaaagcccccttccccaccggcttcgcccccatgctg
gccacgctggttgataaaccttttgatgccgataactggttgtttgaggtaaaatgggat
ggctaccgggctgtggcgcattgtgatggcaaacaggtgtcggttatttcgcgcaacaat
aaatcattcaacgaaaaattctatcccattactgctgccctggaggaattaaatcttcat
gccgtgctggatggggagatcattatttccaataaagaaggcgtctccagttttggcgac
ttgcagaactggcgcagcgaagctgatggtgaattgttgtattatgtatttgacctgtta
tggctgaatgggtatttgctcattgacctgccattacaacaacgcagggacatcctgaaa
aaaatgctgccgcagcatccaaccatacagctaagtcaatcctttgaggcccccggtact
caattttacgaaatggccaaagagatgaacatggaaggcatcattgccaaaaaagccgac
agtgtgtacgtgccgggtgttcgctcaaaagactggctgaagataaagatcgcaaagcgg
caggaagtagtgatcggtggttatacccacaacgaaggttcttccaaattattcagctcg
ctgctggtgggtgtttttgaaaatggggtgttgcattacaccggcaaaataggcaccggt
tttaccgataaagaccagcgcgatatgatggaacagtttaaaccactggtgcgtaaaagc
tgtccgtttggaacagaacccgattataacaagccatcccggttccgccctaatccgcca
aaagcgacagcaatctggttaaaaccccaactggtttgcgaagtagcatttgccgagatc
accagcgatggcgttatgcggcatccttcatttgagggcatgcgcattgataaaaaagca
accgacgtaaaagctgaaaaagccaggccgctgaagatagtagcgcccgaatccattctg
cataaagaaaaaatactcacccgccgctcagccgccgaacgtaaaaccttattaaacccc
ggcgaaaaacaacaggaaaggtccatcaacggatataaactaaaattcagcaacctcaac
aaaatctactggcccaaagaaaagatcaccaagcgcgatttgctgaattattattaccag
gtgtcgccggttattttaccttatttgaaagaccggccccaatcgatgaaccggtttccc
aatggcattgatggcgaaagcttttaccagaaaaatgtaacaggtaaaattccagactgg
atcaacacttttccgtataccgataaaagcgtcaaaaaaagcttcctggtaccggtgcgg
gaagcagatgtattatatatggcttcgctgggctgcattgaaatgaacccctggagcagc
cgggtgcaaaaacccgacaatcccgactggtgtatcattgacctcgaccccgataccaat
acgttcgagcaggtaataaaaaccgcccaggttacacatgagctcctggatagcgcgggt
attcccaattactgtaaaacatccggttcaaccggcattcatatttatatgccgctgggc
gctaaatatgtgtatgaagcttcccgggagtttggccgcctcattgctaccatggtgcac
gaacagctaccccggttcaccagtattgaacggcaaacggccgatagaaaaggaaagatc
tacatcgactttttacagaaccgcccacaagccaccctggcctgcgcctactcccttcgc
cccaaacccggggctacggtttccatgcctttgcattgggaagaagttaagaaagggctt
aaaatgaaagacttcaccattcacaatgcagtggcccgcattaaagaacagggcgatatt
tttaagccggtgctgggtaaaggcattaatatgaaaaaagcaatcgaatcccttcaaaag
cttttacattcctag

DBGET integrated database retrieval system