KEGG   Niastella koreensis: Niako_5480Help
Entry
Niako_5480        CDS       T01679                                 

Definition
(GenBank) Enoyl-(acyl-carrier-protein) reductase (NADH)
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
nko  Niastella koreensis
Pathway
nko00061  Fatty acid biosynthesis
nko00780  Biotin metabolism
nko01100  Metabolic pathways
nko01130  Biosynthesis of antibiotics
nko01212  Fatty acid metabolism
Module
nko_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:nko00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Niako_5480
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Niako_5480
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    Niako_5480
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:nko01004]
    Niako_5480
Enzymes [BR:nko01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     Niako_5480
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     Niako_5480
Lipid biosynthesis proteins [BR:nko01004]
 Fatty acid synthase
  Component type
   Niako_5480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: AEW01715
UniProt: G8THA5
LinkDB All DBs
Position
complement(6823164..6823976)
Genome map
AA seq 270 aa AA seqDB search
MAYNLLKGKKGIIFGALDEKSIAWRTALRCHEEGAQLVLTNAPVALRMGEINKLAEAVNA
PVIGADVTNMDDLKNLFEGAMKHFGGKIDFVLHSVGMSLNVRKNKPYTEIDYGFNQKTLD
ISAMSLHRVLRTAWDLDAISDWGSVVALTYIAAQRVFPDYNEMADAKALLEGVARNFGYH
YGVKKKVRINTISQSPTQTTAGSGVKGFDGFISYAEKMSPLGNASADQCADYCVTLFSDL
TKMVTMQNLFHDGGFSFTGVTQAVIDQMGK
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atggcatataacctgcttaaaggaaagaaagggatcatatttggggcattggatgaaaaa
tcaattgcctggagaacagccttacgttgtcatgaagaaggcgctcagctggtattgacc
aatgcaccggttgctttgcgtatgggcgagatcaataaactggcagaggcagtgaatgcc
cccgtaattggtgccgatgtgaccaatatggacgatctgaagaacctgtttgaaggcgcc
atgaaacattttggcggtaaaatagacttcgtattgcactcagttggtatgagcctgaat
gttcgcaaaaacaagccttataccgaaattgactatggctttaaccaaaagacattagat
atatcagccatgtcgctgcaccgggtattgcgtacagcctgggacctggatgccatcagc
gattggggcagcgtggtagctttaacttatattgcggcacaacgcgtattccccgattat
aacgaaatggccgatgcgaaagcattgctggaaggcgttgcccgcaactttggctatcat
tatggcgtaaagaaaaaagttcgtatcaataccatttcacaatcacccacgcaaactact
gccggtagcggggtaaaaggttttgatggctttatttcttatgccgaaaaaatgagcccg
ctgggtaatgcttcagccgaccaatgcgctgattattgtgttacgctattcagcgactta
accaaaatggttaccatgcagaacctgttccatgatggcggtttctcctttaccggggtt
acgcaggccgttattgatcagatgggtaagtaa

DBGET integrated database retrieval system