KEGG   Niastella koreensis: Niako_5523Help
Entry
Niako_5523        CDS       T01679                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
nko  Niastella koreensis
Pathway
nko00010  Glycolysis / Gluconeogenesis
nko00020  Citrate cycle (TCA cycle)
nko00620  Pyruvate metabolism
nko01100  Metabolic pathways
nko01110  Biosynthesis of secondary metabolites
nko01120  Microbial metabolism in diverse environments
nko01130  Biosynthesis of antibiotics
nko01200  Carbon metabolism
Module
nko_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:nko00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Niako_5523
   00020 Citrate cycle (TCA cycle)
    Niako_5523
   00620 Pyruvate metabolism
    Niako_5523
Enzymes [BR:nko01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Niako_5523
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 DUF2118 PYNP_C GCV_H
Motif
Other DBs
NCBI-ProteinID: AEW01758
UniProt: G8TIE2
LinkDB All DBs
Position
6889316..6890977
Genome map
AA seq 553 aa AA seqDB search
MAEVILMPRLSDTMTEGVIAAWHKKVGDKVKKGDLLAEVETDKATMELESYKDGTLLHIG
TEKGGKLQVNDLLAIIGNPGEDISSLLGGGGQKAAAAPSAPAPEAPKAEQAAAAQPAAAG
GATLDLANMQEVILMPRLSDTMTEGVIAAWHKKVGDNVKKGDLLADVETDKATMELESYK
EGKLLYIGAQKGDKVPVNALLCIIGDEKKVNVDQIVAAAKGGGSSTSAAAAQSQPQAASQ
PAVTASATAETAAPAASGSNGRVLASPLAKKLAADKGIDISKVAGSGDGGRIIKRDIDNY
TPAAGGGQAAQTTAQPGKTTAPAVAGQVSFEDVPVSQMRKVIAKRLSESKFTAPEFYLTM
EINMDKAVESRAKINEIAPVKISFNDMVLKACAIALKQHPKVNSSWMGDKIRVNHHVNIG
VAVAVEEGLLVPVVRFADLKSLSQIGTEVKEFAKKAKDKKLQPSDWEGSTFTISNLGMFG
IEEFTAIINPPDACILAVGAINQVPIVKNGQIVVGNTMKVTLTCDHRVVDGATGAAFLQT
LQQLLEEPLRMLV
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagtgatcttaatgccccgcctgagcgataccatgacagaaggcgtgatagcg
gcctggcataaaaaggtaggcgacaaagtaaagaaaggcgacttactggctgaggtggaa
accgataaagccaccatggaactggaaagttataaagatggcaccctgcttcacattggt
actgaaaaagggggaaaactacaggtaaatgatctgctggccattattggtaacccaggt
gaagatatcagctcgttgcttggtggtggtggtcaaaaagccgctgctgctccatctgcc
ccggcgcctgaagcaccaaaagccgaacaagctgccgccgctcaaccagccgctgccggt
ggcgctacgctcgacctggccaatatgcaggaagtgatcctgatgcctcgcttaagcgat
accatgacagaaggcgttattgccgcctggcataaaaaagtgggcgacaacgttaaaaaa
ggcgacctgctggctgacgtggaaaccgacaaggctaccatggagctggaaagctataaa
gaaggaaaattattatatatcggtgcgcaaaaaggcgataaagttcctgttaacgccctg
ctgtgcatcattggcgacgaaaagaaagtaaatgttgaccagatcgtagctgccgccaaa
ggtggtggttcatctacttctgccgccgctgctcaaagccagccacaagctgcttcccag
cctgctgtaaccgccagcgcaacagccgaaactgccgctcctgccgcatccggcagcaat
ggcagagtgctcgcttcacccctcgctaaaaaattagccgccgataaaggcatcgatatt
tccaaagttgccggttccggcgatggcggccgtatcattaaacgcgatattgacaattat
acgcctgctgcaggtggtggacaagccgctcaaacaactgcacagcctggtaaaactacc
gcccctgccgttgccggccaggtaagctttgaagatgtaccggtttcgcaaatgcgtaag
gtaattgccaagcgtctttctgaaagcaagttcactgcacctgagttctacctcaccatg
gaaatcaacatggataaagccgtagaaagcagagccaaaataaatgaaatagccccggtt
aagatttcgttcaacgacatggtgttaaaagcctgcgctattgccctgaaacaacaccct
aaagtgaacagcagctggatgggcgataagatccgcgttaaccatcatgtgaacatcggt
gtagccgttgctgttgaagaaggcttactggtgcctgttgtacgttttgccgatctgaaa
tcattatcacagattggaactgaagtaaaagagtttgcgaaaaaagcaaaagataaaaaa
ctgcaaccatctgattgggaaggcagcaccttcaccatcagcaacctgggtatgttcggc
attgaagaattcactgccatcattaacccaccagacgcttgtatcctcgctgtaggcgcc
attaaccaggttcctatagtgaagaatggtcagatcgttgttggtaacaccatgaaagtt
accttaacctgcgaccaccgcgtggttgacggagctaccggcgccgccttcctccaaacg
ctgcaacagttgttggaagagccgttgagaatgctcgtttaa

DBGET integrated database retrieval system