KEGG   Niastella koreensis: Niako_5631Help
Entry
Niako_5631        CDS       T01679                                 

Definition
(GenBank) UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
nko  Niastella koreensis
Pathway
nko00473  D-Alanine metabolism
nko01100  Metabolic pathways
nko01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:nko00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Niako_5631
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    Niako_5631
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:nko01011]
    Niako_5631
Enzymes [BR:nko01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Niako_5631
Peptidoglycan biosynthesis and degradation proteins [BR:nko01011]
 Precursor biosynthesis
  Racemase
   Niako_5631
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Mur_ligase_M Mur_ligase Mur_ligase_C Cyclase_polyket
Motif
Other DBs
NCBI-ProteinID: AEW01863
UniProt: G8TJW5
LinkDB All DBs
Position
complement(7029027..7031561)
Genome map
AA seq 844 aa AA seqDB search
MPVQTGKFTDQINRVKYFIDNIASIIKGKWLVQHDNSLIEQLLIDSRKLIFPQTSLFFAL
KGPRRDGHSFIYQLYEKGVRNFVVSEIVDLSKLAEANIVLVDDPLRALQNLVAWHRKQFS
LPVIGITGSNGKTIVKEWLNQLLDDRFTIIRSPKSYNSQIGVPLSVWPLNETHELAIFEA
GISQPGEMEQLQKIIQPTIGIFTNVGEAHSEGFVNVRQKVNEKLQLFRHVQTLIYCQDDP
EINSGVAALWQQIPNNKRFEIFSWSMMSEAMLHIRQVYKEDNTTTITATYQQQEISIVIP
FTDNASVENAIQCWCVLLHLQVPQEEITRQMQQLGPVAMRLELKKGLNNCSIINDSYSSD
LSSFTIALDFLSQQQQHGRRTVILSDILQSGRSEKDLYAEVARLLQQRQVNRLIGIGERI
THHQQIFQSAGIPDLAFYSSVDAFIKELHHIPFKDEVILLKGARIFELEQVDRLLQQKVH
QTVLEIDLTAVAHNLKQFQQRLQPATRIMAMVKAFSYGSGSYEIANALQFHRVDYLAVAY
ADEGVELRKAGINLPIMVMNPEESTFDVLVQYNLEPDLYAPGILSLFEDFVKKQGIQQFP
VHIELETGMNRLGFSMTELPLVINSLRTPLFKVQSVFTHLASSEDPQQDAYTNRQGELYL
QMVQQLQSVLSYPFIKHVVNTAGIIRHPQWHLDMVRLGIGLYGGDSFGEGGLDLREVSTL
KSTIAQIKELKEGETVSYGRKGVVTRDTRIATVRIGYADGYPRKLGNGAGKMFINGHLAP
VIGTVCMDMTMIDITDISHVQEGDEVIIFGTDLPVKQVAHWAQTIPYELLATVSQRVKRV
YFEE
NT seq 2535 nt NT seq  +upstreamnt  +downstreamnt
atgccggtgcagaccgggaaattcactgatcaaattaaccgggtgaaatactttattgac
aatattgcttccatcatcaaagggaagtggcttgttcagcacgataattcgttgattgaa
caactgctcatcgacagccgtaaactcatcttcccacaaacctccctgttctttgccctg
aaagggccgcgccgcgacgggcattcctttatttaccagttgtatgaaaagggtgttcgc
aattttgtggtgagcgaaatcgtagaccttagcaaactggctgaggccaacattgtactg
gttgacgatcctttgcgcgcgctgcaaaacctggtggcctggcaccgcaaacaattcagc
ctgccggtaataggcattaccggtagtaatggaaaaaccattgtaaaggaatggctgaac
cagttgctcgatgaccggttcaccattattcgcagtcccaaaagttacaactcacaaata
ggcgtgcctttaagcgtttggccgttgaacgagacacacgaactggccatttttgaagct
ggtatttcgcaacccggtgaaatggaacaactgcaaaagatcattcaacccaccattggc
atttttaccaatgtgggcgaggcgcacagtgaggggtttgtaaatgtgcggcagaaggta
aatgaaaagctgcaattgttcaggcatgtacaaacacttatttattgccaggacgatcct
gaaataaacagcggggtagccgccttatggcaacaaatacccaacaacaaacgctttgag
atctttagctggagcatgatgagcgaagccatgctgcacattcggcaggtttataaagaa
gataacaccaccactattacggctacttaccagcaacaggagatcagcattgtgattccc
tttaccgataatgcatcggtggagaacgccattcagtgctggtgcgtattgttgcacctg
caggtaccgcaggaagaaataaccaggcaaatgcagcagctggggccggtggccatgcgg
ctggagctgaaaaaaggattgaacaactgctccatcatcaacgatagttacagttcggac
ctcagctcgtttaccattgcccttgattttttaagtcagcagcaacagcatgggaggcga
accgtaatactttcggatattttacaaagcggccggtcagaaaaagacctgtatgccgag
gtggcccgtttgctgcaacagcggcaggtaaaccgccttattggaataggggagcgcatt
acccatcaccagcagatctttcaatcggctggtattcccgacctggcgttttattcgtcg
gtagacgcttttataaaagagctgcatcatattccctttaaggatgaagttattctgtta
aagggcgcccgcatttttgaactggaacaggttgaccgcctgctgcaacagaaggtgcac
caaacggtgctggagatcgatctcactgccgtagcccataacctgaagcagtttcagcaa
cgcttacaaccggctacgcgaattatggccatggtgaaagctttttcgtatggcagcggc
agttatgaaatagccaatgctttacagtttcatcgtgtagattacctggcggtggcctat
gccgatgagggcgtggagttgcgcaaggccggcatcaatttgcccatcatggtcatgaac
cccgaggagtcgacctttgatgtgctggtgcaatacaacctggagcccgatctgtatgca
cccggcattttatctttatttgaagattttgttaaaaaacagggcattcagcagttccct
gtacatatagaattggaaacgggaatgaaccggttgggcttttccatgacggaattaccg
ctggtaataaattcactgcgcacgccgttgtttaaagtgcagtcggtatttacgcacctg
gcgtcgagcgaagacccgcaacaggatgcgtataccaaccggcagggtgaattgtacctg
caaatggtgcagcagttacagtcggttctttcatacccctttataaaacatgtggtgaat
acggccggtattattcgtcatccgcaatggcatcttgacatggtgcggttgggcataggc
ctgtatggcggtgatagttttggggaaggcgggctcgatctgcgggaggtttctaccctg
aaatctaccattgcacagatcaaggagctgaaggaaggagaaacggtgagctatggccgt
aaaggcgtggtaaccagggatacacgtattgccacggtacgcatcggatatgcagacggg
tatccgcgcaagctggggaacggggctggtaaaatgtttatcaatggtcacctggcgccg
gttatcggcacggtatgcatggatatgaccatgattgatattactgatatttcccatgtt
caggagggggacgaggtgataatttttggcaccgatttgcccgtgaaacaagtagctcat
tgggcgcaaaccattccatatgaactgcttgccaccgtttcgcaacgggtgaaaagagtg
tatttcgaggaatag

DBGET integrated database retrieval system