KEGG   Candidatus Nitrosopumilus koreensis: NKOR_05375Help
Entry
NKOR_05375        CDS       T02304                                 

Definition
(GenBank) DNA polymerase I
  KO
K02319  DNA polymerase, archaea type [EC:2.7.7.7]
Organism
nkr  Candidatus Nitrosopumilus koreensis
Pathway
nkr03030  DNA replication
Brite
KEGG Orthology (KO) [BR:nkr00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    NKOR_05375
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:nkr03032]
    NKOR_05375
Enzymes [BR:nkr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     NKOR_05375
DNA replication proteins [BR:nkr03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (archaeal)
    B-family DNA polymerases
     NKOR_05375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol_B DNA_pol_B_exo1 DNA_pol_B_exo2 RNase_H_2
Motif
Other DBs
NCBI-ProteinID: AFS80961
UniProt: K0B955
LinkDB All DBs
Position
888975..891533
Genome map
AA seq 852 aa AA seqDB search
MQVNMGESKKIETMPPSMLVSATYDNNSKSAVLKFYNPESQKLFLWKDEINHKPYCYSRL
APEELEFLQERDDVLEIKTVQRYDLMKDKEVDMSKITVADPLAIGGTSGDKSIRNVIETW
ESDIKYYENYLYDRNLIVGKYYEGVNGSIQPHDLEISDEVKIALKSLLWDKIDSESIVDA
DEFKKFVSEWADLLNQPIPKIKRLSVDIEVEAEIGRIPDPKIAEKKVTAIGMKGTDGFDQ
IFVLKTEGTEEGVNELEQNIKVIFYDSDKEKKMIHDAFKLIKEFPFVVTYNGDEFDLPYL
YNRAERLGIKNSENPFYMMRDSATLKHGVHLDLYRTFSNRSFQIYAFSQKYTNFSLNSVC
KALLGKEKIDYGLEFDQLSLYQTANYCYNDALLTYELTSFNNELLMQLLIIISRIGRMPI
DDIARMGVSQWIRSLLYYEHRKRNYLIPKRQELERRSEGVMSDAVIKDKKYRGGLVVEPK
EGIHFDVVVMDFASLYPSIIKVRNLSYETVRCPHEECKKNTIPGTNHWTCSKKNGITSMI
IGSLRDLRVNYYKSLSKKETLTDEQRQQYTVVSQALKVILNASYGVMGAEIFPLYFLPAA
EATTAIGRHTILETIKKCESAGIKVLYGDTDSLFIKNPTKEQIQTVIEQAKKDHGVDLEI
DKTYRYCVLSNRKKNYLGVTKEGKVDVKGLTGKKSHTPPFIKKLFYELLDVLSSVQTIED
FERAKKEISEKIATCGKKVEAKEIPLEDLTFNVMLSKAPSEYTKTIPQHIRAAKQLETIR
EIKKGDRISYIKILNKPGVKPVEMAKKEEIDSKKYMEFMEATLEQITSSMNLDFDTILGK
PKQTGLDEFFWN
NT seq 2559 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtcaatatgggagaatctaaaaaaattgaaacaatgccaccatcaatgttagtg
tcagcaacatatgataacaattcaaaatcggcagttttaaagttctataatccagaatct
caaaaattatttttatggaaagatgaaattaatcataaaccatattgctattcaagactt
gccccagaagaattagaatttcttcaagaaagagatgacgtattagaaattaaaacagtt
caacgatatgacctgatgaaagacaaagaggtagacatgtcaaaaattacagtagcggat
ccacttgcaattggaggcacatctggagacaagagtattagaaacgtaattgaaacatgg
gaatcagacatcaaatattatgaaaattatctatacgacagaaatctaatagtgggaaaa
tattacgaaggtgtaaacggaagcattcaaccccatgatttagaaatttctgatgaagta
aaaattgccctaaagagtttgttgtgggataagattgacagcgaaagtattgtagatgca
gatgaatttaaaaaatttgtttctgaatgggcagatttgctcaatcaaccaattccaaag
atcaaaagactgagcgtagacattgaagttgaagctgaaatcggaaggattccagaccca
aagattgcagaaaaaaaagtaactgcaatagggatgaaaggaacggatgggtttgaccaa
atttttgtgctcaaaacagaaggaacagaagaaggggtaaatgaattagagcaaaacatc
aaggtcatattctatgattcagataaagaaaaaaaaatgattcatgacgcatttaagttg
atcaaagaatttccgtttgttgtaacatacaatggggatgaatttgatttaccatatcta
tacaatagagcagaaagactagggataaaaaattcagaaaatccgttttacatgatgcgt
gattctgcaacattgaaacatggagttcatcttgatttgtatagaacattttcaaataga
tcatttcaaatctacgcatttagtcaaaaatacacaaatttttcactaaatagtgtctgt
aaagcactacttggaaaagaaaagatagattacggattagaatttgatcaattgtcgcta
tatcaaactgcaaattattgttacaatgatgcattactgacatatgaacttacaagtttt
aacaatgaactgctgatgcaattattgataatcatttcaagaattgggaggatgccaatt
gatgatattgcaagaatgggagtatcacaatggattcgaagtcttttgtattacgaacat
agaaaaaggaattatctcattccaaaaagacaggaattagaaagaagatcagaaggggta
atgtctgatgcagttatcaaagacaaaaaatacagaggaggactagtggttgaaccaaaa
gagggaattcattttgatgttgttgtaatggactttgcaagtctgtatcctagcattatc
aaggtcagaaatttatcgtatgagactgtcaggtgcccacatgaagaatgtaaaaaaaat
acaattccaggaacgaatcactggacttgttcaaagaaaaacggcattacatcaatgatc
ataggttcattgagggatttgagggtaaattactacaagagtttatcaaaaaaagagaca
cttactgatgagcaaagacagcaatacacagtagtaagtcaagcacttaaagtaattcta
aatgcaagttatggggtgatgggagctgagatattcccattatattttctgcctgcagca
gaagctaccaccgcaattggaaggcacacaattttagagacaatcaaaaaatgtgaatct
gcaggaatcaaagttctttatggagatacagattcattatttatcaaaaatccaactaaa
gaacagattcaaacagtaatcgagcaagcaaaaaaagatcacggtgttgacttagaaatt
gacaaaacatacaggtattgtgttctaagtaacagaaagaaaaattatctaggagtaacc
aaagaaggaaaagtagacgtcaaaggccttacaggaaaaaaatcacacacaccaccattt
atcaagaaattattttacgaattacttgatgtgttgtccagtgttcaaacaattgaagat
tttgaaagagccaaaaaagaaatttctgaaaaaattgccacatgcggcaaaaaagtagaa
gcaaaagaaatcccactagaagatctgacattcaacgtaatgcttagcaaagcaccatca
gaatatacaaaaacaattccacaacatatccgagcagcaaaacaactagaaacaataagg
gagataaagaaaggagacagaatatcctacatcaaaattctaaacaaaccaggagtaaaa
cctgtagagatggcaaaaaaagaagagattgattctaaaaaatacatggaatttatggaa
gcaacattggaacagattacatcatcaatgaatttggattttgatacaattttaggaaag
ccaaaacaaacaggattagacgaatttttctggaattag

DBGET integrated database retrieval system