KEGG   Neisseria lactamica: NLA_16210Help
Entry
NLA_16210         CDS       T01368                                 

Definition
(GenBank) putative polyamine permease inner membrane protein
  KO
K11075  putrescine transport system permease protein
Organism
nla  Neisseria lactamica
Pathway
nla02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:nla00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    NLA_16210
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:nla02000]
    NLA_16210
Transporters [BR:nla02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Putrescine transporter
    NLA_16210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 DUF4634
Motif
Other DBs
NCBI-ProteinID: CBN87827
UniProt: E4ZEP1
LinkDB All DBs
Position
complement(1738315..1739280)
Genome map
AA seq 321 aa AA seqDB search
MNLKKLKNKLFRRPGRRAVIAVPYIWLLVLFLIPFAIVLKISFAEQEIAIPPFTPLTSID
EDLGRLNIAVSYQNYADIFQNFWSTLNPFGDSENSNIYLMTYWSSIKTALTTTVICLLVG
YPTAYAISRADPSVRNGLLLAIMLPFWTSFLLRVYAWMGLLGHNGIVNNLLIKMGIISEP
LDLFYNAFSLNLVMVYAYLPFMILPLYTQLVKLDNRLLEAASDLGAGPVKSFLTITLPLS
KTGIIAGSMLVFVPAVGEFVIPELVGGSENLMIGKVLWQAFFDQNNWPLASAVAVVMVAL
LVVPIALFQHYENRELEEGAK
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgaaccttaaaaaactgaaaaacaaactgttccgccgcccgggccggcgcgcggtgatt
gccgtgccgtatatttggcttttggtgctgtttctgattccgttcgccatcgtgctgaaa
atcagctttgccgaacaagaaatcgccattccgccgtttacgccgctgaccagcatcgat
gaggatttaggccgtctgaacattgctgtcagctatcaaaactatgccgatattttccaa
aatttttggagcacccttaatccgttcggcgacagtgaaaacagcaatatctatctgatg
acttattggtcctcgataaaaacggcattgacgacgacggttatttgcctgttggtcggt
tatccgaccgcctatgcgatttcccgtgccgacccatccgtccgcaacggtctgctgctt
gccattatgctgcccttttggacatcgttcctgctgcgcgtctatgcgtggatgggtttg
ctcgggcataacggcattgtaaacaacctgttgattaaaatgggtattatcagcgagcct
ttggatttgttctacaatgccttttcgctcaatttggtgatggtttatgcctatctgccg
tttatgattctgccgctatacacgcaactggtgaaactcgacaaccgcctgctcgaagca
gcttccgatttgggtgcgggaccggttaagtcgttcttgacgattacactgcctttgtct
aaaacaggcattattgcaggttcgatgctggttttcgttcccgcagtcggcgagttcgtc
attcccgagctggtcggcggctcggaaaacctgatgatcggtaaagtcttgtggcaggcg
ttcttcgatcaaaacaactggccgctggcttccgccgtcgccgttgtgatggttgcgctg
ctggtcgtgccgattgccctgttccagcattatgaaaaccgcgaattggaagaaggagcc
aaataa

DBGET integrated database retrieval system