KEGG   Neisseria lactamica: NLA_16270Help
Entry
NLA_16270         CDS       T01368                                 

Definition
(GenBank) hypothetical membrane protein
  KO
K03210  preprotein translocase subunit YajC
Organism
nla  Neisseria lactamica
Pathway
nla02024  Quorum sensing
nla03060  Protein export
nla03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:nla00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    NLA_16270
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    NLA_16270
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    NLA_16270
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:nla02044]
    NLA_16270
Secretion system [BR:nla02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   NLA_16270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YajC Orf78 CusF_Ec
Motif
Other DBs
NCBI-ProteinID: CBN87832
UniProt: E4ZEP6
LinkDB All DBs
Position
complement(1744055..1744321)
Genome map
AA seq 88 aa AA seqDB search
MNQAVAQFAPLVLIMVVFYFLIMRPQQKKFKAHQAMLAALKVGDKVVLAAGFKGRVTKVG
EQFYTVDIGQGAKIEVEVERNAVAAKAE
NT seq 267 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaggctgttgcacaatttgctcctttagtgttgattatggtggtgttctacttc
ttgattatgcgtccgcagcaaaagaaattcaaagcacaccaggcgatgttggccgctttg
aaggtcggcgacaaagtcgttttggcggcaggttttaaaggacgtgtaaccaaagtcggc
gagcaattctatactgtcgacatcggacaaggcgcgaaaatcgaagtggaagtcgagcgc
aacgcggttgccgcaaaagccgagtaa

DBGET integrated database retrieval system